OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 126 - 150 of 360.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Log halfway down tangent at 8585 ft"×
Data×

Seismic Survey 2016 Metadata at San Emidio, Nevada

Dec 05, 2016
54.86 MB
Publicly accessible
1301 Vertical Component seismic instruments were deployed at San Emidio Geothermal field in Nevada in December 2016. The first record starts at 2016-12-05T02:00:00.000000Z (UTC) and the last record ends at 2016-12-11T14:00:59.998000Z (UTC). Data are stored in individual files in o...
Authors
Lord, N. et al University of Wisconsin
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadareporttechnical specificationintrumentationspecsspecspecifications

Rare Earth Element Concentrations in Geothermal Wells at the Puna Geothermal Field, Hawaii

Dec 09, 2016
729.5 kB
Publicly accessible
Rare earth element concentrations in the geothermal wells at the Puna geothermal field, Hawaii. Samples taken from geothermal wells KS-5, KS-6W, KS-9W, KS-14E, and KS-16N. Includes pH and concentrations for Cerium, Dysprosium, Erbium, Europium, Gadolinium, Holmium, Lanthanum, Lute...
Authors
Fowler, A. and Zierenberg, R. University of California
geothermalenergypunahawaiirare earth elementsreebrinegeothermal fluidsconcentrationsaqueous chemistryusgin content modelngds content modelcedyereugdholalundprsmtbtmyyb

Brine Stability Study

Apr 15, 2015
1.75 MB
Publicly accessible
This is a study of the brine formulations that we were using in our testing were stable over time. The data includes charts, as well as, all of the original data from the ICP-MS runs to complete this study.
Authors
Garland, G. Tusaar Corp.
geothermalbrinestabilitysimplebrine studyreerare earth elementsnakcasodiumcalciumpotassium

Feasibility of a Deep Direct-Use Geothermal System at the University of Illinois Urbana-Champaign

Dec 31, 2018
6.08 MB
Publicly accessible
Paper authored by Stumpf et al. for the 2018 Geothermal Resources Council Annual Meeting held in Reno, NV USA. Included with the paper is the Microsoft PowerPoint presentation made at the GRC meeting and data tables associated with some of the figures.
Authors
Stumpf, A. et al University of Illinois
geothermalenergyuniversity of illinois at urbana-champaignddudeep direct-useillinois basingeocellular modelingwellbore modelingtemperaturewellwellboremodelingfeasibilitycharacterizationillinois

WHOLESCALE Catalog of Rock Samples at San Emidio Nevada collected in January 2021 Version 2.0

Jan 12, 2021
21.28 kB
Publicly accessible
This submission includes an update to the WHOLESCALESamples2021January.xls file where the strikes and dips initially reported have been corrected to comply with the right hand rule. The updated excel file and a link to the original submission are included in this report. The ori...
Authors
Kleich, S. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsan emidionevadarock samplesgeologyimagesphotoscore samplesgeophysicssamplesrockraw data

Pressure-Temperature Simulation at Brady Hot Springs

Jul 11, 2017
2.96 MB
Publicly accessible
These files contain the output of a model calculation to simulate the pressure and temperature of fluid at Brady Hot Springs, Nevada, USA. The calculation couples the hydrologic flow (Darcy's Law) with simple thermodynamics. The epoch of validity is 24 March 2015. Coordinates are ...
Authors
Feigl, K. Temple University
geothermalenergyinsar-meqporotomoinsarmicroseismicitymeqmicroearthquakeseismicityinducedsimulationpressuretemperaturebradybrady hot springs

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

WHOLESCALE: Seismic Survey Data from San Emidio Nevada 2021

Apr 06, 2021
1.67 TB
Publicly accessible
This dataset includes raw and processed seismic data from the 2021 seismic survey at the San Emidio geothermal field in Nevada. In April and May 2021, 37 tri-axial short period seismographs were deployed in a 1.8km diameter cluster centered on 40.367278 N, 119.409019 W. The first...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsacraw dataprocessed datageophysicssiesmic datasmartsolodatacubeseismographdata lakesan emdidionevadapumpingtri-axialdld

PoroTomo: Horizontal Distributed Acoustic Sensing (DAS) Measurements During an M 2.3 Explosion

Dec 18, 2018
198.67 GB
Publicly accessible
Included here are Distributed Acoustic Sensing (DAS) data collected by the horizontal DAS array at Brady's Hot Springs Geothermal Field. The system recorded this data during an M 2.3 explosion at the Nevada Test Site (NTS), which is located approximately 400km southeast of the fie...
Authors
Kratt, C. et al Center for Transformative Environmental Monitoring Programs (CTEMPs)
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicaldasbradys hot springsdtsporotomoseismicgeophysicsdas datasgyseg-ydistributed acoustic sensingdistributed temperature sensinghydrothermaltrenchedsurface sensorsseismicityraw data

DEMO-FTES Test 1: Water Flow, Pressure, Temperature, and Electrical Conductivity Data

Apr 16, 2025
6.33 GB
Publicly accessible
This dataset contains 1-second and hourly resolution water flow rate, pressure, temperature, and electrical conductivity data collected during Test 1 of the DEMO Fracture Thermal Energy Storage (FTES) project at the Sanford Underground Research Facility (SURF) between December 10,...
Authors
Burghardt, J. et al Pacific Northwest National Laboratory
geothermalenergyfracture thermal energy storageftesunderground thermal energy storagesanford underground research facilitysurfflow ratepressure datatemperature dataelectrical conductivityinjectionproductionborehole monitoringthermal circulation testsubsurface datademo-ftesfield experimentprocessed datathermal energy storagetesbtesutes

Exploration for Blind Geothermal Resources in the State of Hawaii Utilizing Dissolved Noble Gasses in Well Waters

Nov 01, 2020
139.07 kB
Publicly accessible
This study is an extension of the Hawaii Play Fairway Analysis (PFA), a statewide geothermal exploration project funded by the United States Department of Energy. Based on results from prior phases of the PFA, this project targeted 66 wells on the islands of Hawaii, Maui, Lanai, O...
Authors
Ferguson, C. University of Hawaii
geothermalenergyhawaiiplay fairwaykilaueamauilanaikauainoble gasheliumtrace metalr/raisotopeindicatorindicator gasresource detection

Garner Valley DAS Metadata

Sep 10, 2013
21.69 kB
Publicly accessible
Metadata for the data collected at the NEES@UCSB Garner Valley Downhole Array field site on September 10-12, 2013 as part of the larger PoroTomo project.
Authors
Lancelle, C. University of Wisconsin
geothermaldistributed acoustic sensingfiber opticsporotomogarner valleydownhole arraymetadata

Distributed Acoustic Sensing (DAS) of Strain at Earth Tide Frequencies: Laboratory Tests

Jan 24, 2018
1.09 GB
Publicly accessible
The solid Earth strains in response to the gravitational pull from the Moon, Sun, and other planetary bodies. Measuring the flexure of geologic material in response to these Earth tides provides information about the geomechanical properties of rock and sediment. Such measurements...
Authors
Coleman, T. and Becker, M. California State University
geothermalenergyearth tidedasdistributed acoustic sensingfiber optics sensorslow frequency straingeomechanicsmeasurementmatlabegslab testsfracturecharacterizationhydraulicstimulation strain

CO2 Push-Pull Single Fault Injection Simulations

Sep 21, 2017
24.3 MB
Publicly accessible
ASCII text files containing grid-block name, X-Y-Z location, and multiple parameters from TOUGH2 simulation output of CO2 injection into an idealized single fault representing a dipping normal fault at the Desert Peak geothermal field (readable by GMS). The fault is composed of a ...
Authors
Borgia, A. et al Lawrence Berkeley National Laboratory
geothermalenergyco2 injectionfault characterizationfault imagingseismic imagingegstough2gmsfracturespermeable flow pathspermeability characterizationidentificationcarbon dioxideinjectionproductionfault sensitivityfault systemfracture systemrock propertiesfluid mechanicspressure transientstimulationreservoir

Renewable Energy Potential Model: Hawaii Geothermal Supply Curves

Jan 13, 2025
102.89 kB
Publicly accessible
This dataset extends the development of the Renewable Energy Potential (reV) model to include geothermal energy, with a specific focus on Hawaii. Provided here are the results of two scenarios that were modeled for geothermal energy in Hawaii: binary enhanced geothermal systems (E...
Authors
Trainor-Guitton, W. et al National Renewable Energy Laboratory
geothermalenergysupply curvegeospatialhawaiirevlevelized cost of energyhydrothermalcapital costgeothermal locationlcoeegspfaplay fairwaysimulationmodelmodel resultsheat mapbinary egsbinary hydrothermaltransmissiongrid connectiondevelopmentfeasibilityproduction metricssupply curves

Utah FORGE 3-2417: Pulsed Interference Tests at Wells 16A(78)-32 and 16B(78)-32 September 2024

Mar 18, 2025
8.73 MB
Publicly accessible
This archive contains data and a report from Pulse Interference Tests (PITs), which were conducted on September 4, 2024, immediately following a 30-day recirculation test at the Utah FORGE site. Injection and backflow were induced in well 16A(78)-32 while pressures were measured i...
Authors
W Becker, M. et al Rice University
geothermalenergypulse injection testhydraulicsutah forgeegsstimulationhydraulic parametershydraulic testingcirculation testinjectionbackflowpit16a16breservoir testingpulse interference testformation pressureinjected volumereservoir characterizationprocessed datatechnical report

Great Salt Lake Composition and Rare Earth Speciation Analysis

Apr 19, 2017
424.34 kB
Publicly accessible
We have conducted aqueous speciation analyses of the Great Salt Lake (GSL) brine sample (Table 1) and a mock geo sample (Table 2) spiked with 1 ppb Tb and 100 ppb Tb. The GSL speciation (Figure 1) aligns with our basic speciation expectations that strong carbonate complexes would ...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergyrare earthadsorptionbiosorptiongslspeciationterbiumtbgreat salt lakereeelementaqueouschemistrybrine

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

DEEPEN: Newberry Volcano MT and Gravity Data 2022 and 2023 Acquisition and Processing

Jun 30, 2023
306.16 GB
Publicly accessible
As part of DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments), a 3D play fairway analysis (PFA) was conducted at Newberry Volcano in Central Oregon for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). For use in this PFA, ...
Authors
Schultz, A. et al Enthalpion Energy
geothermalenergydeepennewberrymtgravityresistivitydensitysingle inversionjoint inversioninversionraw dataprocessed datauncertaintyresolution matrixexplorationcharacterizationegshydrothermalsuperhot egssupercriticalmagmaticgeophysicsmt impedance3-d modeldaily reportsoregonpfaplay fairway analysis

Utah FORGE: Groundwater Data

Jul 20, 2016
621.85 kB
Publicly accessible
This submission includes two modeled drawdown scenarios with new supply well locations, a total dissolved solids (TDS) concentration grid (raster dataset representing the spatial distribution of TDS), and an excel spreadsheet containing well data.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmilfordutahegsforgegroundwaterdrawdownwellsupplytdsconcentrationgeochemistrywellsconcentrationsmodelaquifertesttransducerdataflow ratescenariowater tablemodelledpredictedpotentialgeospatial dataarcgisgisshapefileshape fileutah forgelocationwell locationreservoirsupply wellroosevelt hot springsresourcecharacterizationwell data

WHOLESCALE Catalog of Rock Samples at San Emidio Nevada collected in January 2021

Jan 12, 2021
857.7 MB
Publicly accessible
This submission contains information on thirty-six rock samples collected from San Emidio, Nevada during January, 2021 for Subtask 2.3 of the WHOLESCALE project. The following resources include a .zip of rock sample photos taken in the field, a .zip of rock sample photos taken in ...
Authors
Kleich, S. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsan emidionevadarock samplesfieldsamplessamplerock samplegeologyimagesphotoscore samples

WHOLESCALE: Coordinates of wells at San Emidio, Nevada

Sep 25, 2023
2.13 kB
Publicly accessible
This dataset includes position coordinates and elevation information for wells at the WHOLESCALE San Emidio project location. Well positions in the attached file are characterized by UTM coordinates (Easting, Northing) in meters, and WHOLESCALE coordinates (Easting, Northing) rel...
Authors
Cardiff, M. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalcoordinateswell locationwell informationsan emidiogeospatialstress evolutionnevada

Validation of Innovative Exploration Technologies for Newberry Volcano: Geochemistry Data from Wells 55-29 and 46-16

Jan 01, 2012
Size unavailable
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: DOE Geochemistry data from deep wells 55-29 and 46-16 at Newberry 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
newberryvolcanooregoncalderainnovative exploration technologiesgeochemistrydatawellsiet55-2946-16deepwellexplorationhydrothermalegs

Brady's Geothermal Field DAS and DTS Surface and Borehole Array Metadata

Mar 31, 2016
3.71 MB
Publicly accessible
This metadata submission includes the coordinates of the DAS and DTS surface and borehole arrays, the list of file names, and the list of recorded files during testing at the PoroTomo Natural Laboratory at Brady Hot Spring in Nevada. Testing was completed during March 2016.
Authors
Fratta, D. University of Wisconsin
geothermaldasdtsfiber opticseismic arraytemperature arrayssurface sensorsborehole sensorscoordinatesfile listingfile listdata collection gapsdas datahorizontal arraymetadatautm coordinatesmetersborehole arrayboreholedistributed temperature sensingdistributed acoustic sensingseismic monitoringpassive monitoringgeophysics
<< Previous12345678910Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service