OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 151 - 170 of 170.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"USGIN content model"×
Data×

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas, Part 2

Mar 01, 2019
3.53 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texasheat flowsmusouthern methodist universitymemodeep direct-usegeological variabilitytravis peakpermitreservoireastman chemicalcross-sectionsabine upliftheatflownreltxdduthermal conductivitypermittingregulatory agenciesland accesssurface watersurface heat flowgeologic variability evaluation

Oilwell Conversion (Well API 121913310501) to Geothermal Heat Storage Well for Flexible Electricity Storage

May 05, 2021
2.86 GB
Publicly accessible
Geothermal growth is limited by a lack of geographically dispersed high-temperature thermal resources and high initial upfront investment in characterization and well construction. This project intended to address the challenges of energy supply intermittency and enhance grid resi...
Authors
Malkewicz, N. et al University of Illinois
geothermalenergycypress reservoirgeothermal modellingoilwell conversioninjection/extraction testingenergy storagegeothermal energy storagewell conversionheat storageheat storage wellsheat injectiongamma ray logspressure testtemperature datasubsurface thermalthermal storagesubsurface thermal storage

Hawaii Play Fairway Analysis: Lanai Resistivity and Density 3D Inversion Models

Jun 01, 2020
42.2 MB
Publicly accessible
To prepare for its third phase, the Hawaii Play Fairway project conducted groundwater sampling and analyses in ten locations in the Hawaiian islands, magnetotelluric (MT) and gravity surveys, as well as calculations of 3D subsurface stress due to the weight of the rock underlying ...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaimagnetotelluricgravityhaleakalamauimauna keamtmasurveydatateststresssubsurfacevolcanoresistivitydensityfracture induced permeabilityegsenhanced geothermal systemresourcepotentialresource probabilityexploratory drilling

High-Pressure and High-Temperature (HPHT) Lost Circulation Material (LCM) Testing

Nov 30, 2021
7.92 MB
Publicly accessible
High-pressure and high-temperature (HPHT) lost circulation material (LCM) rheology test results, LCM particle size distributions (PSD) analysis, and HPHT LCM fluid loss test results. Three academic papers / reports derived from this research are also presented.
Authors
Salehi, S. and Vivas, C. University of Oklahoma
geothermalenergylost circulation materialshpht filtrationfracture sealingparticle size distributionrheologydrilling fluid additivesgelationthermal degradationhigh pressure high temperaturepsdtemperaturemodeldrillingwellboreexperimenttechnologyprocessed datalcm

Utah FORGE: Laboratory Experiments Examining the Effect of Thermal and Mechanical Processes on Hydraulic Transmissivity Evolution

Apr 03, 2023
858.13 kB
Publicly accessible
Using laboratory slide-hold-slide experiments, at temperatures from 22 to 200 degrees C, to examine effects of fracture reactivation and quasi-static loading on the evolution of fluid transport properties of simulated fractures in Westerly granite. At all temperatures, the in-plan...
Authors
Lockner, D. et al United States Geological Survey
geothermalenergyutah forgehydraulic transmissivityfluid-rock interactionsshear fracturessealinggranite

InSAR Maps of Deformation Covering Raft River, Idaho from 2007 to 2010

Mar 11, 2007
196.13 MB
Curated
This dataset contains maps of deformation covering Raft River, Idaho from 2007 to 2010 calculated from interferometric synthetic aperture radar data. This dataset is used in the study entitled "Inferring geothermal reservoir processes at the Raft River Geothermal Field, Idaho, US...
Authors
Reinisch, E. University of Wisconsin
geothermalenergyraft river geothermal fieldinsarenvisatsatelliteinterferometric synthetic aperture radaregsreservoir developmentreservoir modeling

Pilgrim Hot Springs: GEOPHIRES Inputs and Outputs for Direct-Use Geothermal District Heating and Cooling

Mar 21, 2024
211.86 kB
Publicly accessible
This dataset includes files for a techno-economic analysis conducted using the GEOPHIRES simulator to examine the feasibility of expanding a larger district heating site in a remote location: Pilgrim Hot Springs, Alaska. Files included here are GEOPHIRES inputs and outputs for fiv...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergygeophireschporcparallel cycletopping cyclepilgrim hot springsalaskatechno-economic analysisfeasibilityteareservoir simulationsheat demandcapitaloperating costsdistrict geothermaldistrict heatingmodelmodelingpythongithubinputsoutputs

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Data of High-Temperature Dynamic LCM Testing Setup

May 31, 2021
9.94 MB
Publicly accessible
Data from high temperature dynamic sealing tests for various fracture widths, at various temperatures (degrees F), with 5 wt.% bentonite-based mud containing various material fiber contents, at 100 to 400 psi differential pressure. Data from pressure test and evaluation of the dy...
Authors
Magzoub, M. et al University of Oklahoma
geothermal drillinglost circulationshape memory polymergranitefractureswellbore strengtheningsealabilitygeothermalenergylost circulation materialssealing pressurefiltrationsmart lcmsmpfracture sealingdrilling fluid additivestemperaturemodeldrillingwellboreexperimenttechnologyprocessed data

Cascades/Aleutian Play Fairway Analysis: Data and Map Files

Nov 15, 2015
1.44 GB
Publicly accessible
Contains Excel data files used to quantifiably rank the geothermal potential of each of the young volcanic centers of the Cascade and Aleutian Arcs using world power production volcanic centers as benchmarks. Also contains shapefiles used in play fairway analysis with power plant...
Authors
Shevenell, L. ATLAS Geosciences Inc
geothermalworld volcanic centersplay fairwaycascadesaleutianspfaplay fairway analysisgis datamap datamap packagegeochemistrygeothermometryspringswellsfumarolessurface areapower plantsmw capacitiessurface areasvolcanic ventsrock typevolcanic centersstructural characteristicstectonic settingshapefilesaleutiangeochemsitry datastructural datageospatial data

G-Function Library for Modeling Vertical Bore Ground Heat Exchanger

Jun 30, 2021
234.14 MB
Publicly accessible
This library contains g-functions (thermal response functions) for standard, regularly spaced vertical borehole ground heat exchangers. In total, it contains 34, 321 configurations. To permit interpolation, each configuration has g-functions for heights of 24, 48, 96, 192, and 384...
Authors
Spitler, J. et al Oak Ridge National Laboratory
geothermalenergyheat pumpground heat exchangerg-functionlibrarythermal response functionssimulationground heat pumpghpmodelheat exchanger

Cornell Ithaca Campus heat use data for a model year

Nov 13, 2019
2.07 MB
Publicly accessible
Hourly steam use data for all significant buildings from the fiscal year (FY) 2017 (1 July 2016 30 June 2017) are provided. The total annual campus heating load in FY 2017 was about 0.81 trillion Btu (283,000 MWth-hrs). The data are presented as a spreadsheet, detailing on an ho...
Authors
Beyers, S. and Gustafson, J. Cornell University
geothermalenergycornell universitydistrict heatingdirect-use heatingnew york stateenergy meteringbuilding heat demandappalachian basinlow-temperature geothermalddusteam datadirect useheat pumpghptemperatureearth source heateaenvironmentenvironmentalassessmentheatingsteam use data

New River Geothermal Exploration (Ram Power Inc.)

Nov 15, 2013
675.7 MB
Publicly accessible
The New River Geothermal Exploration (DOE Award No. EE0002843) is located approximately 25km south of the Salton Sea, near town of Brawley in Imperial County and approximately 150km east of San Diego, California. A total of 182 MT Logger sites were completed covering the two sepa...
Authors
Mirza, R. and Data, E. Ram Power, Inc.
geothermalmagnetotelluric surveymt surveyresistivitymesquitenew rivernorth americaimperial countyelectronic data exchangeedispacial modelspacial modelingsdmseismic reflection surveyfaultsbrawleycaliforniareportsite namesdaily survey notesparallel sensor testspatial modelingsurvey files1ddepth profilesresistivity models2d3ddepth plan mapsmapsgeosoftgeophysical modeling toolsgeotoolsgocadsoftwareappendixvibration monitoringsurvey notesgeospatial data

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Utah FORGE: 2D and 3D Seismic Data

Mar 16, 2018
127.26 GB
Publicly accessible
This set of data contains raw and Initially-processed 2D and 3D seismic data from the Utah FORGE study area near Roosevelt Hot Springs. Reprocessed versions of these data can be accessed at the linked submission in the Resources section titled "Reprocessed Seismic Reflection Data....
Authors
Miller, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismicseismic datautahutah forgeforgeroosevelt hot springs3d seismic data2d seismic dataseg-ycorrelateduncorrelatedgeophysicsactive sourcerawprocesseddataraw dataprocessed datavelocityegsmilford

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim
<< Previous234567
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service