OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 66.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"downhole array"×
Data×

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

EGS Collab Experiment 2: Microseismic Monitoring

May 28, 2024
230 TB
Publicly accessible
This dataset contains continuous seismic waveform data recorded during stimulation and thermal circulation tests for the Enhanced Geothermal Systems (EGS) Collab Experiment #2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Da...
Authors
Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergymicroseismicwaveformcontinuous seismicstimulationcirculationsurf3caccelerometerhydrophoneborehole arrayegs collabraw datacontinuous waveformbinaryseedobspytechnical reportgeophysicsmicroseismicity

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

Brady's Geothermal Field DASH Resampled in Time

Jul 07, 2017
7.44 TB
Publicly accessible
This submission includes a link to the DASH (Horizontal distributed acoustic sensing) data files that were resampled in time to 100 samples per second from the original 1000 samples per second files. Data is in 30 second Matlab files organized into directories by day. The README_D...
Authors
Feigl, K. University of Wisconsin
geothermalporotomodasfiber opticdistributed acoustic sensingsurface sensorsseismic arraybrady hot springnevadaporoelastic tomographymatlabhorizontalgeophysicsdash

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data

Utah FORGE: Source Imaging DAS-Based Seismic Event Catalog April 2024 Stimulation

Aug 26, 2025
140.41 kB
Publicly accessible
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a DAS-specific source imaging workflow that avoids conventional phase picking. Instead, STA/LTA-transformed DAS and downhole...
Authors
Dvory, N. et al The University Of Utah
geothermalenergyforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationapril 2024 stimulation

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Maui Aeromagnetic Survey

Apr 17, 2010
90.3 MB
Publicly accessible
Map, image, and data files, and a summary report of a high-resolution aeromagnetic survey of southern Maui, Hawai'i completed by EDCON-PRJ, Inc. for Ormat Nevada Inc using an helicopter and a towed sensor array.
Authors
Akerley, J. Ormat Nevada Inc
geothermalhawaiimauiaeromagaeromagneticssurveymagnetometergeometricshaleakalavolcanototal magnetic intensityreduced to polehorizontal gradienttiltderivative

Utah FORGE: Focal Mechanism Catalog from Stage 3 of the April 2022 Stimulation Test

Sep 15, 2025
107.98 kB
Publicly accessible
This submission includes focal-mechanism solutions derived from the Utah FORGE April 2022 Stage-3 stimulation. Waveforms were extracted around each event (short windows bracketing origin times) from the downhole three-component arrays in wells 58-32, 78-32, and 56-32 and the surfa...
Authors
Mohammadi, A. et al Texas A and M University
geothermalenergyforgeutah forgeegsmilfordutahmagnitudestage 3hydraulic stimulationstrikedipkagan anglemoment-tensor inversionmtfitbayesian inversiongeophysicsgeophysical inversionfocal-mechanismsevent catalogdeep-learningamplitude ratios

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Utah FORGE: Well 58-32 Schlumberger FMI Logs DLIS and XML files

Nov 17, 2017
2.4 GB
Publicly accessible
This zipped data set includes Schlumberger FMI logs DLIS and XML files from Utah FORGE deep well 58-32. These include runs 1 (2226-7550 ft) and 2 (7440-7550 ft). Run 3 (7390-7527ft) was acquired during phase 2C.
Authors
Nash, G. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsfmifmi logswell 58-32fmi xmlfmi dlis58-32 fmifullboreformationmicroimagerimagingmicroimagingboreholeloggingloggeophysicsdip set logsutah geothermal58-32welldeepdliswell logxmlutahmilfordegsresourcecharacterizationwell data

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

EGS Collab Experiment 2: Distributed Fiber Optic Acoustic Data (DAS)

May 28, 2024
212.2 TB
Publicly accessible
Distributed fiber optic sensing was an important part of the monitoring system for EGS Collab Experiment #2. A single loop of custom fiber package was grouted into the four monitoring boreholes that bracketed the experiment volume. This fiber package contained two multi-mode fiber...
Authors
Rodriguez Tribaldos, V. and Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 2distributed acoustic sensingdassilixaidasterra15trebleoptasenseodh3hdf5tdmsraw datastrain ratemulti-mode fibersingle-mode fibergeophysics

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Brady's Geothermal Field Analysis of Pressure Data

Mar 17, 2017
10.13 MB
Publicly accessible
*This submission provides corrections to GDR Submissions 844 and 845* Poroelastic Tomography (PoroTomo) by Adjoint Inverse Modeling of Data from Hydrology. The 3 *csv files containing pressure data are the corrected versions of the pressure dataset found in Submission 844. The ...
Authors
Lim, D. University of Wisconsin
geothermalenergyproduction flow rate datainjection flow rate datapressure datahydrologyhydrogeologybrady hot springsporotomoporoelastic tomographyegsenhanced geothermal systemsengineered geothermal systemsdeployment databradybradys geothermal fieldpressureflow rateboreholedownholewell datapressure sensorobservation wellspumping testwater pressureobservation well

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Oilwell Conversion (Well API 121913310501) to Geothermal Heat Storage Well for Flexible Electricity Storage

May 05, 2021
2.86 GB
Publicly accessible
Geothermal growth is limited by a lack of geographically dispersed high-temperature thermal resources and high initial upfront investment in characterization and well construction. This project intended to address the challenges of energy supply intermittency and enhance grid resi...
Authors
Malkewicz, N. et al University of Illinois
geothermalenergycypress reservoirgeothermal modellingoilwell conversioninjection/extraction testingenergy storagegeothermal energy storagewell conversionheat storageheat storage wellsheat injectiongamma ray logspressure testtemperature datasubsurface thermalthermal storagesubsurface thermal storage

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa
<< Previous123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service