OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 301 - 325 of 379.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"thermal energy network"×
Data×

Utah FORGE: InSAR Data from 2020

Dec 24, 2020
982.9 MB
Curated
Interferometric Synthetic Aperture Radar data from the TerraSAR-X and the TanDEM-X satellite missions operated by the German Space Agency (DLR). Interferometric pairs (interferograms) were created using generic mapping tool GMT-SAR processing software (see link in Resources). Data...
Authors
Batzli, S. and Feigl, K. University of Wisconsin
geothermalenergyutah forgeforgeutah geothermalreservoirengineeringhydraulicfracturingegsraw datapreprocessed datainsarremote sensing

DEEPEN 3D PFA Weights for Exploration Datasets in Magmatic Environments

Jun 30, 2023
62.15 kB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the development of the DEEPEN 3D play fairway analysis (PFA) methodology for magmatic plays (conventional hydrothermal, superhot EGS, and supercritical), weights needed to be develop...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsmagmatichydrothermalweightspfapcaexpertahpanalytical hierarchy processexplorationcharacterization

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Utah FORGE 3-2417: Meteorological Data During 2023 Completion/Circulation

Jun 10, 2024
2.4 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the completion/cementing of well 16B(78)-32 and the initial 2023 circulation test, largely occurring in June/July/August of 2023. This information may p...
Authors
Ajo-Franklin, J. Rice University
geothermalenergyutahutah forgeegsenhanced geothermalmeteorological datameteorologywell 78-16circulationcompletiontemperaturewindhumidityprecipitationtime seriesraw datacalibrationinstrument calibration78-16

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation

Brady's Geothermal Field Analysis of Pressure Data

Mar 17, 2017
10.13 MB
Publicly accessible
*This submission provides corrections to GDR Submissions 844 and 845* Poroelastic Tomography (PoroTomo) by Adjoint Inverse Modeling of Data from Hydrology. The 3 *csv files containing pressure data are the corrected versions of the pressure dataset found in Submission 844. The ...
Authors
Lim, D. University of Wisconsin
geothermalenergyproduction flow rate datainjection flow rate datapressure datahydrologyhydrogeologybrady hot springsporotomoporoelastic tomographyegsenhanced geothermal systemsengineered geothermal systemsdeployment databradybradys geothermal fieldpressureflow rateboreholedownholewell datapressure sensorobservation wellspumping testwater pressureobservation well

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing

EGS Collab Experiment 1: Well Locations and Orientations.

Sep 05, 2018
657.91 kB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsigma-vsurfwell locationegsstimulationhydraulicfracturingtestbed 1west access driftsanford underground research facilityboreholesgeophysical monitoringreflex gyroorientationslaser/lidermagnetic orientation survey

EGS Collab Experiment 2: Preliminary Test Wells Locations and Orientations

Dec 19, 2019
233.95 kB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergysurfegs collabgyro datahydraulic fracturinghydraulic shearingsanford underground research facilitywell locationswellstestbed 2lidarremote sensingegsexperiment 2well locationwell orientationsigma-vtest wellswell dataleapfroghomestake mineboreholegyrocollar location

Utah FORGE 5-2419: Fluid Injection Experiments on Granite Samples at Four Different Temperatures

Sep 05, 2024
6.76 MB
Curated
This dataset contains results from four fluid injection experiments at 24 C, 69 C, 111 C, and 140 C using a triaxial loading apparatus ("Temco"). Tests were conducted on a Utah FORGE granite sample with a 30 degree inclined fracture. Confining pressure was maintained at 10 MPa, wh...
Authors
Wang, J. and Elsworth, D. Pennsylvania State University
geothermalenergyfluid injection experimentutah forgeegsfluid injectionfractured granitetriaxial loadingpermeabilityseismic momentconfining pressurepore pressureshear stresselevated temperatureexperimental datageomechanicsstimulationhydraulic stimulation

Ionic Fluids for EGS: Microfluidic Injectivity and Reversibility Data for Geothermal Working Fluids

Sep 13, 2025
22.36 MB
Curated
This dataset contains raw experimental data from microfluidics-based injectivity and reversibility tests of ionic liquids (ILs) and alternative fluids (AFs). Fluids were injected through individual and combined microchannels at three temperatures (18 C, 50 C, and 80 C), and differ...
Authors
Akhilome, C. and Bikkina, P. Oklahoma State University
geothermalenergymicrofluidicsegsionic fluids for egsinjectivityreversibilitygeothermal fluidsionic liquidspressure dropflow ratemicrochannel testingenhanced geothermal systemsgeothermal fluid dynamicslaboratory datageochemistryraw datamicrochannel flowfluid transportgeothermal testingdaq systemdifferential pressure analysis

Retrospective Analysis of Geothermal Mineral Recovery and Domestic Resource Assessment References

Oct 20, 2021
1.69 MB
Curated
This reference database in RIS format contains all of the references that were collected as part of our retrospective analysis of geothermal mineral recovery (REE and Li) activities and domestic resource assessment. The outputs detail the chemistry and molecular processes used in ...
Authors
Dobson, P. and Stringfellow, W. Lawrence Berkeley National Laboratory
geothermalenergylithiumreemineral recoveryrecoverygeothermal brinesbrinesgeochemistytechnologydomestic resourceresourcemineral

Utah FORGE: Direct Shear Tests on Saturated Sierra White Granite Joints at Elevated Temperatures

Nov 24, 2025
2.38 MB
Curated
This dataset contains results from laboratory direct shear experiments performed on tension-induced fractures in Sierra White granite under saturated conditions at target temperatures of 50 C and 100 C. The data were collected using a custom water-pressurized chamber equipped with...
Authors
Han, K. et al Purdue University
geothermalenergyutah forgesaturationgranitesierra white granitelab testdirect shear testshear strengthshear stressgeophysicsp-waves-waveelastic wave propagationegslaboratory datafracturesdirect shearraw datageomechanicssaturated fracturesshear displacementeffective normal stresspore pressureultrasonic measurementsgeophysical responserock mechanicsstimulation

Cornell University Borehole Observatory Sidewall Core Data

Jul 16, 2026
385.18 MB
In progress
This data set includes sidewall core data from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 and total dep...
Authors
Tester, J. et al Cornell University
geothermalenergycornell universitycubodeep direct usedistrict heatingddudeep wellwell datadrillingesh-1api 31109300030000appalachian basin

Cape EGS: Frisco Pad Flow Test Microseismic DAS Data

Feb 11, 2026
21.05 GB
Curated
This dataset contains microseismic data acquired during the Frisco pad flow test project led by Fervo Energy, conducted between August and September 2025 near the Utah FORGE geothermal site. The data were recorded using a Distributed Acoustic Sensing (DAS) fiber installed in well ...
Authors
Kanu, O. Fervo Energy
geothermalenergycape egsegsfervo energyutah forgedistributed acoustic sensingdasfiber-optic sensingmicroseismic monitoringinduced seismicitywell 16bfrisco padflow teststrain-ratehdf5h5silixa idasdownhole fiber-optic sensinggeophysicsraw data

Utah FORGE: 2D and 3D Seismic Data

Mar 16, 2018
127.26 GB
Publicly accessible
This set of data contains raw and Initially-processed 2D and 3D seismic data from the Utah FORGE study area near Roosevelt Hot Springs. Reprocessed versions of these data can be accessed at the linked submission in the Resources section titled "Reprocessed Seismic Reflection Data....
Authors
Miller, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyseismicseismic datautahutah forgeforgeroosevelt hot springs3d seismic data2d seismic dataseg-ycorrelateduncorrelatedgeophysicsactive sourcerawprocesseddataraw dataprocessed datavelocityegsmilford

Utah FORGE: Well 16A(78)-32 Drilling Data

Jan 08, 2021
2.57 GB
Publicly accessible
This dataset includes survey data, drilling data, daily reports, summaries of daily operations, and rig photos from the drilling of Utah FORGE well 16A(78)-32, which is a highly deviated deep well. It was completed 60 days ahead of schedule. Rig move in began 10/22/2020 and dril...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedrillingdirectional16a78-32time seriessurveytrajectoryraw dataegsrigphotosoperationsdeviateddeep wellhighly deviatedforgeutahpasonpason data

EGS Collab Experiment 2: Distributed Fiber Optic Acoustic Data (DAS)

May 28, 2024
212.2 TB
In curation
Distributed fiber optic sensing was an important part of the monitoring system for EGS Collab Experiment #2. A single loop of custom fiber package was grouted into the four monitoring boreholes that bracketed the experiment volume. This fiber package contained two multi-mode fiber...
Authors
Rodriguez Tribaldos, V. and Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 2distributed acoustic sensingdassilixaidasterra15trebleoptasenseodh3hdf5tdmsraw datastrain ratemulti-mode fibersingle-mode fiber

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs

S-Layer Nanosheet Binding of Zn and Gd

Apr 15, 2016
20.72 kB
Publicly accessible
This data characterizes binding of Zn2+ and Gd3+ to engineered nanosheets at 40C and in a brine solution. The engineered nanosheets are composed of surface-layer (S-layer) proteins which form 2 D crystalline sheets and display Zn2+ or Gd3+-binding domains on these sheets. Their ab...
Authors
Ajo-Franklin, C. et al Lawrence Berkeley National Laboratory
geothermalenergymineral recoverysynthetic biologys-layermetal-binding domainnanosheetbrine studybindingchemistrygadoliniumzincgd3zn2ion

Effective Elastic and Neutron Capture Cross Section Calculations Corresponding to Simulated Fluid Properties from CO2 Push-Pull Simulations

Mar 07, 2018
4.46 MB
Publicly accessible
The submission contains a .xls files consisting of 10 excel sheets, which contain combined list of pressure, saturation, salinity, temperature profiles from the simulation of CO2 push-pull using Brady reservoir model and the corresponding effective compressional and shear velocity...
Authors
Chugunov, N. and Altundas, B. Lawrence Berkeley National Laboratory
geothermalenergyco2carbon dioxidepush-pullactive seismicwell loggingegsneutron capturesnuparstimulationsensitivity analysischaracterizationfaultfracturefluidbrine

Hawthorne Nevada Deep Direct-Use Feasibility Study 3D Seismic

Mar 29, 2018
467.07 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. et al Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduopendtectpstmprestack time migrationfault interpretationhawthornegeospatial data

Hawthorne Nevada Deep Direct-Use Feasibility Study Navy Geothermal Program Office General Data

Mar 29, 2018
693.88 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorne

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Full Moment Tensors and Stress Inversion Catalogs

Sep 26, 2018
51.03 kB
Publicly accessible
This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the P...
Authors
Gritto, R. et al Array Information Technology
geothermalenergyseismic moment tensorstress orientationstress changesinversiongeysersegsenhanced geothermalazimuthplungemincroseismicityinjectionstimulationreservoirthe geysershigh temperature reservoirfull mtsolutionspassiveseismicseismicitymicroseismicitymonitoringarraymomenttensorcataloganalysisinducedstressprati 32demonstrationfracturespatio-temporalgenerationresourcedevelopmenthydraulicfaultingfaultearthquakegeophysicsgeophysical

Utah FORGE: Earth Model Mesh Data for Selected Surfaces

Dec 07, 2018
20.83 MB
Publicly accessible
This submission contains a number of data files with vertices of meshed/interpolated surfaces used in the Phase 2B earth model. Examples include land surface (based on 10-meter DEM), the granitoid-basin fill contact, several faults, and also interpolated temperature isosurfaces f...
Authors
Podgorney, R. Idaho National Laboratory
geothermalenergystudent competitionearth modelforgeroosevelt hot springsutahdemdigital elevation modelgeospatial datacoordinateisosurfacefaultstructurestructuraldatalocationland surfacetemperatureopal moundnegro magegsmilfordenhanced geothermal systemutah forgemodelingmodellingmesh datagranitoidtoptopographygeologybasin fillresourcecharacterizationprocessed data
<< Previous8910111213141516Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service