OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 144.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"seismic monitoring"×
Data×

Brady's Geothermal Field Seismic Network Metadata

Dec 21, 2014
38.38 kB
Publicly accessible
Brady's geothermal field seismic network station locations and dates of operation.
Authors
Foxall, W. University of Wisconsin
geothermalegs microearthquake monitoringbrady egs seismic monitoring networkmetadataseismic networkseismic monitoringbradyegsporotomoseismicitymicroseismicitymeqinduced seismicitybradys geothermal fieldbradys hot springsearthquake

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs

EGS Collab Experiment 2: Microseismic Monitoring

May 28, 2024
230 TB
Publicly accessible
This dataset contains continuous seismic waveform data recorded during stimulation and thermal circulation tests for the Enhanced Geothermal Systems (EGS) Collab Experiment #2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Da...
Authors
Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergymicroseismicwaveformcontinuous seismicstimulationcirculationsurf3caccelerometerhydrophoneborehole arrayegs collabraw datacontinuous waveformbinaryseedobspytechnical reportgeophysicsmicroseismicity

Utah FORGE: Earthquake Catalog

Mar 21, 2018
66.71 kB
Publicly accessible
This is the set of earthquake catalogs developed for the Utah FORGE project covering December of 2016 through March of 2018. These are discussed in the "Utah FORGE Phase 2B Final Topical Report," which can be found on GDR under id: 1038 (See link 'Final Topical Report' in resource...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge seismicityseismicityearthquakeearthquakesgeospatial dataearthquake catalogsutah forge earthquake catalogsutahutah forgeutah forge 2broosevelt hot springsmilfordforgephase 2bmicroseismicitymonitoringseismicmicroseismicegsprocessed datareportcatalogresourcecharacterization

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Utah FORGE 3-2417: DAS-derived Moment Tensors from the 16A/16B Stimulation April, 2024

Aug 22, 2025
1.41 MB
Publicly accessible
This dataset contains a catalog of moment tensors derived from distributed acoustic sensing (DAS) data acquired during stimulation of Utah FORGE Well 16A, conducted between April 3 and April 7, 2024. The data were generated as part of the FOGMORE (Fiber Optic MOnitoring for Reserv...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicmoment tensorenhanced geothermalegsfogmoresilixa16a stimulationdistributed acoustic sensingfiber opticsseismic monitoringstimulationmicroseismicitycarinaidasseismic inversiongeophysicssubsurface characterizationseismic momentconfidence indexcondition numbermoment catalogprocessed data

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Utah FORGE: Site Earthquake Animation

Mar 13, 2016
1.14 MB
Publicly accessible
This is a .kml earthquake animation covering the period of 1991 2011 for the Utah Milford FORGE site. It displays seismic events using different sized bubbles according to magnitude. It covers the general Utah FORGE area (large shaded rectangle) with the final site displayed as a ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsearthquakesgeospatialsimulationseismologyarcgisgoogle earthseismicityseismic monitoringbackgroundutahgeospatial dataearthquakeanimationtime lapseeventmagnitude

Brady's Geothermal Field Reftek Seismometer Metadata

Mar 26, 2016
457.21 kB
Publicly accessible
Metadata for the Reftek seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatareftekseismometerseismicarraypassive seismicporotomobradygeophysicsmonitoringseismicity

CO2 Push-Pull Single Fault Injection Simulations

Sep 21, 2017
24.3 MB
Publicly accessible
ASCII text files containing grid-block name, X-Y-Z location, and multiple parameters from TOUGH2 simulation output of CO2 injection into an idealized single fault representing a dipping normal fault at the Desert Peak geothermal field (readable by GMS). The fault is composed of a ...
Authors
Borgia, A. et al Lawrence Berkeley National Laboratory
geothermalenergyco2 injectionfault characterizationfault imagingseismic imagingegstough2gmsfracturespermeable flow pathspermeability characterizationidentificationcarbon dioxideinjectionproductionfault sensitivityfault systemfracture systemrock propertiesfluid mechanicspressure transientstimulationreservoir

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Improved Microseismicity Detection During Newberry EGS Stimulations

Oct 01, 2013
23.03 kB
Publicly accessible
Effective enhanced geothermal systems (EGS) require optimal fracture networks for efficient heat transfer between hot rock and fluid. Microseismic mapping is a key tool used to infer the subsurface fracture geometry. Traditional earthquake detection and location techniques are oft...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsseismicitymicroseismicitystimulationfracturereservoirearthquakesmonitoringmicroseismicseismicnewberry

Brady's Geothermal Field DAS and DTS Surface and Borehole Array Metadata

Mar 31, 2016
3.71 MB
Publicly accessible
This metadata submission includes the coordinates of the DAS and DTS surface and borehole arrays, the list of file names, and the list of recorded files during testing at the PoroTomo Natural Laboratory at Brady Hot Spring in Nevada. Testing was completed during March 2016.
Authors
Fratta, D. University of Wisconsin
geothermaldasdtsfiber opticseismic arraytemperature arrayssurface sensorsborehole sensorscoordinatesfile listingfile listdata collection gapsdas datahorizontal arraymetadatautm coordinatesmetersborehole arrayboreholedistributed temperature sensingdistributed acoustic sensingseismic monitoringpassive monitoringgeophysics

Newberry EGS Literature References

Apr 22, 2016
69.94 kB
Publicly accessible
Research references to literature about the Newberry geothermal area, Oregon.
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengeophysicsgeologyhydrothermalseismicstructurep waveelectricmagnetotelluriclithologyliteraturefield guidegeologic historyvolcano hazardsframeworkpetrologyexploratory drillingslimholeexplorationflow testingdrillholestructuralactive sourceteleseismictomographyresource characterizationmagma chambercrustalvelocitygravityemelectricalcompressional wavecoremineralogy

Newberry EGS Well Logs, Earthquakes, Maps, Cross-Sections, and LiDAR Datasets

Apr 22, 2016
13.4 kB
Publicly accessible
Datasets and information used to characterize the subsurface of Newberry and support modeling efforts. Includes sources for well logs, earthquakes, maps & cross-sections, and LiDAR/DEM
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewgennewberryoregonearthquakesseismicgeologic maplidardemdatasetmodelwell logearthquakeseismicitymapcross-sectionremote sensing

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Improved Microseismicity Detection During Newberry EGS Stimulations

Nov 01, 2013
214.5 kB
Publicly accessible
Effective enhanced geothermal systems (EGS) require optimal fracture networks for efficient heat transfer between hot rock and fluid. Microseismic mapping is a key tool used to infer the subsurface fracture geometry. Traditional earthquake detection and location techniques are oft...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsseismicitymicroseismicitystimulationfracturereservoirngds content modelusgin content modelinduced seismicitynewberrymicroearthquakemonitoringmeasurementdetectionhydrualic

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Full Moment Tensors and Stress Inversion Catalogs

Sep 26, 2018
51.03 kB
Publicly accessible
This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the P...
Authors
Gritto, R. et al Array Information Technology
geothermalenergyseismic moment tensorstress orientationstress changesinversiongeysersegsenhanced geothermalazimuthplungemincroseismicityinjectionstimulationreservoirthe geysershigh temperature reservoirfull mtsolutionspassiveseismicseismicitymicroseismicitymonitoringarraymomenttensorcataloganalysisinducedstressprati 32demonstrationfracturespatio-temporalgenerationresourcedevelopmenthydraulicfaultingfaultearthquakegeophysicsgeophysical

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

New River Geothermal Exploration (Ram Power Inc.)

Nov 15, 2013
675.7 MB
Publicly accessible
The New River Geothermal Exploration (DOE Award No. EE0002843) is located approximately 25km south of the Salton Sea, near town of Brawley in Imperial County and approximately 150km east of San Diego, California. A total of 182 MT Logger sites were completed covering the two sepa...
Authors
Mirza, R. and Data, E. Ram Power, Inc.
geothermalmagnetotelluric surveymt surveyresistivitymesquitenew rivernorth americaimperial countyelectronic data exchangeedispacial modelspacial modelingsdmseismic reflection surveyfaultsbrawleycaliforniareportsite namesdaily survey notesparallel sensor testspatial modelingsurvey files1ddepth profilesresistivity models2d3ddepth plan mapsmapsgeosoftgeophysical modeling toolsgeotoolsgocadsoftwareappendixvibration monitoringsurvey notesgeospatial data

Utah FORGE 3-2417: Meteorological Data During 2024 Stimulation

May 09, 2024
2.08 MB
Publicly accessible
This preliminary data archive includes meteorological data recorded at the Utah FORGE facility over the period of time including the 16A/16B stimulation activities, largely March/April/May of 2024. This information may prove useful for understanding seismic and other instrumentati...
Authors
Ajo-Franklin, J. Rice University
geothermalutah forgeweather datatime seriesegsstimulationmeterology16a16btemperaturewindprecipitationhumiditydew pointatmospheric pressureinstrumentation responsecalibrationraw data

EGS Collab Experiment 1: SIMFIP Notch-164 GRL Paper

Sep 24, 2020
11.52 MB
Publicly accessible
Characterizing the stimulation mode of a fracture is critical to assess the hydraulic efficiency and the seismic risk related to deep fluid manipulations. We have monitored the three-dimensional displacements of a fluid-driven fracture during water injections in a borehole at ~1.5...
Authors
Guglielmi, Y. Lawrence Berkeley National Laboratory
geothermalenergysimfipnew borehole instrumenthydrofractureegs collabnucleateanisotropyshear displacementwellboreexperimentstimulationseismicseismicityfracturehydraulic conductivitystressshearboreholemicro-shearingfoliationinjection testsanford underground research facilitysurfegshydraulicgeophysicsdisplacementflow rate
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service