OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 43.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"passive acoustic"×
Document×

Utah FORGE: Borehole PSS Tools Status Report

Dec 29, 2022
6.52 MB
Publicly accessible
This report summarizes the data quality from the Utah FORGE borehole passive seismic sensors (PSS) tools at well sites 58-32 and 78B-32. Two level Avalon tools were installed on 09-28-2022 and 09-29-2022 by representatives from Avalon, Schlumberger, University of Utah, and Instrum...
Authors
Stachnik, J. Instrumental Software Technologies, Inc.
geothermalenergyutah forgeseismic sensorsseismicseismicityborehole seismic sensorsborehole passive seismic sensorspsspassive seismic sensorsseismic sensing tools

Brady's Geothermal Field DAS and DTS Surface and Borehole Array Metadata

Mar 31, 2016
3.71 MB
Publicly accessible
This metadata submission includes the coordinates of the DAS and DTS surface and borehole arrays, the list of file names, and the list of recorded files during testing at the PoroTomo Natural Laboratory at Brady Hot Spring in Nevada. Testing was completed during March 2016.
Authors
Fratta, D. University of Wisconsin
geothermaldasdtsfiber opticseismic arraytemperature arrayssurface sensorsborehole sensorscoordinatesfile listingfile listdata collection gapsdas datahorizontal arraymetadatautm coordinatesmetersborehole arrayboreholedistributed temperature sensingdistributed acoustic sensingseismic monitoringpassive monitoringgeophysics

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

University of Illinois Campus Deep Direct-Use Feasibility Study Design of Injection Well #1 (CCS1)

Mar 30, 2018
631.29 kB
Publicly accessible
Includes specification sheet, wellbore geometry, and drilling fluids at section target depth associated with the design of Injection Well #1 (CCS1) for the Illinois Basin Decatur Project (IBDP).
Authors
Greenberg, S. University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoisillinois basinibdpwell ccs1well specsspecificationsinjectiontemperaturepressureseismic sensingpassiveseismic monitoringdtspermits

Filenames of Data from the Distributed Acoustic Sensing Experiment at Garner Valley, California

Jul 01, 2015
295.4 kB
Publicly accessible
In September 2013, an experiment using Distributed Acoustic Sensing (DAS) was conducted at Garner Valley, a test site of the University of California Santa Barbara (Lancelle et al., 2014). This submission lists all file names from Distributed Acoustic Sensing (DAS) data collected...
Authors
Lancelle, C. et al University of Wisconsin
geothermalporotomodasegsdistributed acoustic sensingfilenamesdirectivitysensitivityfiber-opticsground motionmeasurement

DCIF Westerly Granite AE Stress Effect Test (Task 3-1)

Jul 08, 2021
216.62 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on rectangular Westerly granite blocks (width=depth=4.0", height=2.0"). Liquid nitrogen was poured in a small, 1"-diameter copper cup attached to the top of the sample, and the resulting acoustic emissions (A...
Authors
Nakagawa, S. and Trzeciak, M. Lawrence Berkeley National Laboratory
geothermalenergythermal fracturingstress measurementfracturingprocessed datageophysicsstress testinggranitewesterly granitestressmicrofracturefracturedatatemperatureacoustic emissionacoustic emission locationacoustic emission rate

Utah FORGE: Laboratory Shear Experiments Linking Fault Roughness, Friction, Permeability, and P-Wave Characteristics

Aug 20, 2025
23.22 GB
Publicly accessible
This dataset contains results from five laboratory shear experiments on gneiss and granitoid samples from the Utah FORGE site, conducted at Penn State University. The experiments investigate links between fault surface roughness, frictional behavior, permeability, and P-wave acous...
Authors
Eijsink, A. et al Pennsylvania State University
geothermalenergyfrictionroughnessutah forgeegslaboratory datamodeled datashear experimentsfault mechanicspermeabilityp-waveacoustic transmissivityfault roughnessrate-and-state frictionbiaxial deformationgneissgranitoidoptical profilometrykeyencersfit3000mechanical dataacoustic datafault zone propertiesgeomechanicsrock physicsgeothermal reservoir characterization

DCIF (Directional Cooling-Induced Fracturing) Westerly Granite AE Borehole Damage Effect Test (Task 3-0)

Jan 27, 2022
162.51 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on three rectangular Westerly granite blocks (width=depth=4.0", height=2.0") which were preheated to 200, 400, and 600 degree C to induce damage (microcracks) with varying degrees. Liquid nitrogen was poured...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalenergydirectional cooling induced fracturingdcifdirectional cooling-induced fracturingdamage effect testfracturemicrocrackthermal stressacoustic emissionaccousticsthermal fracturefailure testraw dataprocessed datastressbiaxial stresswesterly graniteborehole damage effecttestwesterlygranite

Reservoir Stimulation Optimization with Operational Monitoring for Creation of EGS

Sep 15, 2014
21.38 MB
Publicly accessible
EGS field projects have not sustained production at rates greater than 1/2 of what is needed for economic viability. The primary limitation that makes commercial EGS infeasible is our current inability to cost-effectively create high-permeability reservoirs from impermeable, igneo...
Authors
A., C. Pacific Northwest National Laboratory
geothermalstressvolume expansionpermeabilityfracturingrheoreversible fluidsxmtacoustic emissionlaboratory scaleegsigneous rockacoustic signaturefracture responsex-ray microtomography

Utah FORGE 5-2419: Final Report and Presentation on Seismicity Permeability Relationships Probed via Nonlinear Acoustic Imaging

Sep 30, 2025
254.88 MB
Publicly accessible
This submission contains the final technical report and closeout presentation for Utah FORGE Project 5-2419, which investigates the coupled evolution of permeability and induced seismicity in enhanced geothermal systems using laboratory experiments, field observations, and nonline...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegspermeabilityinduced seismicitylaboratory experimentsfield observationsnonlinear acoustic imagingfault reactivationreservoir rockmicroearthquakestimulationphysics informed modelingmachine learningseismic momentstress statepermeability creationseismic hazardtechnical reportgeomechanicsgeophysicsmicroseismicity

Utah FORGE: Well 16B(78)-32 Stimulation Hydraulic Fracturing In-Well DAS Fiber Optic Monitoring Report April 2024

Apr 26, 2024
10.46 MB
Publicly accessible
The report reviews results obtained by Neubrex using Distributed Acoustic Sensing (DAS) during the 16B(78)-32 hydraulic fracturing operations, Stages 1–4. It details DAS data acquisition, processing, and analysis, with a focus on acoustic noise signatures recorded during each st...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergydasinjection allocationplug efficacyfrequency band extractionfbehydraulic fracturinghfneubrexdistributed acoustic sensinggeophysicsplug holdingpumping dataprocessed dataanalysistechnical reportutah forgeegspumping curve data16b78-32fiber optic monitoringstimulation

Seismic Survey 2016 Metadata at San Emidio, Nevada

Dec 05, 2016
54.86 MB
Publicly accessible
1301 Vertical Component seismic instruments were deployed at San Emidio Geothermal field in Nevada in December 2016. The first record starts at 2016-12-05T02:00:00.000000Z (UTC) and the last record ends at 2016-12-11T14:00:59.998000Z (UTC). Data are stored in individual files in o...
Authors
Lord, N. et al University of Wisconsin
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadareporttechnical specificationintrumentationspecsspecspecifications

Utah FORGE 5-2419: Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging 2025 Workshop Presentation

Sep 18, 2025
128.96 MB
Publicly accessible
This is a presentation on the Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging project by Pennsylvania State University, presented by Derek Elsworth. The project's objectives were to explore controls and acoustic signatures of aseismic through seismic ev...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegsseismicitypermeabilitynonlinear acoustic imagingfracture reactivationfriction stabilitystress statestimulationgeomechanics2025 annual workshoppresentationpresentation recordingpresentation slidesreport

Distributed Acoustic Sensing (DAS) Data for Periodic Hydraulic Tests: Hydraulic Data

Jul 31, 2015
4.26 MB
Publicly accessible
Hydraulic responses from periodic hydraulic tests conducted at the Mirror Lake Fractured Rock Research Site, during the summer of 2015. These hydraulic responses were measured also using distributed acoustic sensing (DAS) which is cataloged in a different submission under this gr...
Authors
Cole, M. California State University
geothermalenergyperiodic hydraulic testsinterference testsdaspulse interference testsdistributed acoustic sensinghydraulic testingmatlabacoustic sensing data

Sample Data from a Distributed Acoustic Sensing Experiment at Garner Valley, California

Sep 10, 2013
133.84 MB
Publicly accessible
In September 2013, an experiment using Distributed Acoustic Sensing (DAS) was conducted at Garner Valley, a test site of the University of California Santa Barbara (Lancelle et al., 2014). This submission includes one 45 kN shear shaker (called "large shaker" on the basemap) test ...
Authors
Lancelle, C. University of Wisconsin
geothermalporotomodasmapaccelerometergeophonegarner valleycaliforniadistributed acoustic sensingfiber-opticfiber opticsvibroseisposterproject summary

Utah FORGE 3-2417: Simulations for Distributed Acoustic Sensing Strain Signatures as an Indicator of Fracture Connectivity

Jan 01, 2023
21.99 MB
Publicly accessible
This dataset encompasses simulations of strain signatures from both hydraulically connected and "near-miss" fractures in enhanced geothermal systems (EGS). The files and results are presented from the perspective of digital acoustic sensing's (DAS) potential to differentiate the t...
Authors
Ward-Baranyay, M. et al Rice University
geothermalenergyforgeutah forgeegsmilfordutahcomsoldfnmatlabsimulationnear-miss fracturedasdistributed acoustic sensingmodelingstrainfogmoregeophysicshydrogeomechanicssub-nanostraincodestimulation

Reservoir Stimulation Optimization with Operational Monitoring for Creation of EGS

Sep 25, 2013
65.42 MB
Publicly accessible
EGS field projects have not sustained production at rates greater than half of what is needed for economic viability. The primary limitation that makes commercial EGS infeasible is our current inability to cost-effectively create high-permeability reservoirs from impermeable, igne...
Authors
A., C. Pacific Northwest National Laboratory
geothermalfracturing fluidmonitoringxmtnmracousticrheologypermeabilityegsigneous rock

Brady's Geothermal Field DASH Resampled in Time

Jul 07, 2017
7.44 TB
Publicly accessible
This submission includes a link to the DASH (Horizontal distributed acoustic sensing) data files that were resampled in time to 100 samples per second from the original 1000 samples per second files. Data is in 30 second Matlab files organized into directories by day. The README_D...
Authors
Feigl, K. University of Wisconsin
geothermalporotomodasfiber opticdistributed acoustic sensingsurface sensorsseismic arraybrady hot springnevadaporoelastic tomographymatlabhorizontalgeophysicsdash

Utah FORGE 3-2417: DAS Microseismic Event Records From Circulation Test July 2023

Jul 09, 2025
17.07 GB
Publicly accessible
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (waveforms) recorded during the 16A-16B circulation tests conducted at the Utah FORGE site in July 2023 as part of the FOGMORE R&D project (Utah FORGE Project 3-2417). Data were acquired using Sil...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdasdistributed acoustic sensingmicroseismiccirculation testfiber optic monitoringsilixa carinasilixa idas v2nanostrain rateseismic dataseg-yjuly 2023raw datatriggeredchannel map

Utah FORGE: Report on Fiber Optic Monitoring of August 2025 Circulation and Huff and Puff Tests

Mar 06, 2026
14.67 MB
Publicly accessible
This is a technical report on the acquisition, processing and analysis of fiber optic data collected in the Utah FORGE 16B(78)-32 well during cross well circulation tests and huff and puff testing that were executed by Texas Tech University and California Statue University Long Be...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergyfiber opticsrfs dssdssdasdtstexas techcsulbhuff and puffcross well circulationthermal datawell 16b16b78-32distributed acoustic sensingdistributed strain sensingdistributed temperature sensinggeophysicsprocessed datatechnical report

Washington Geothermal Play Fairway Analysis Technical Report

Dec 20, 2017
139.29 MB
Publicly accessible
An investment of $0.7M from the Geothermal Technology Office for Phase 2 of Play Fairway Analysis in Washington State improved existing favorability models and increased model confidence. New 1:24,000-scale geological mapping, 15 detailed geophysical surveys, 2 passive seismic sur...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergywashingtonplay fairwayexplorationinvestigationsitecharacterizationgeophysicpfawashington stategeospatial datavelocitygrid filesstrainfavorability

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Directional Cooling-Induced Fracturing Westerly Granite Test Results

Dec 18, 2020
72.48 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on a short, cylindrical sample of Westerly granite (diameter = 4 inches, height ~ 2 inches). Liquid nitrogen was poured in a copper cup attached to the top of the sample, and the resulting acoustic emissions ...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalthermal crackingacoustic emissionstemperature changeslaboratory experimentwesterly granitegranitemoment tensorfractureseismicgeophysicsliquid nitrogenthermaltemperaturestimulationdirectional coolinginduced fracturingdirectional cooling-induced fracturingwellborestressvelocitytomographymicrocracking

Utah FORGE 3-2417: DAS Microseismic Event and MT Catalog from the 16A/16B Circulation Test [Final, Relocated], 2023

May 19, 2025
1.34 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog from distributed acoustic sensing (DAS) acquisition conducted during the 16A-16B circulation tests that took place in July 2023. These results update the catalog presented in GDR 1613 (the preliminary catalog, lin...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalevent catalog16a16bcirculationcirculation testinversionseismic eventsevent detectionmtdistributed acoustic sensingprocessed datamicroseismic event catalogmeqfogmore
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service