OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 156.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Production data"×
Other×

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Publicly accessible
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

DEEPEN 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jun 30, 2023
3.62 GB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. Part of the DEEPEN project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfamodellingmodelingcharacterizationexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponent

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Raw Neutron Scattering Data for Strain Measurement of Hydraulically Loaded Granite and Marble Samples in Triaxial Stress State

May 23, 2014
22.11 MB
Publicly accessible
This entry contains raw data files from experiments performed on the Vulcan beamline at the Spallation Neutron Source at Oak Ridge National Laboratory using a pressure cell. Cylindrical granite and marble samples were subjected to confining pressures of either 0 psi or approximate...
Authors
Polsky, Y. Oak Ridge National Laboratory
geothermalneutronstrainhydraulic fracturingegsdiffractiongranitemarbletriaxialhydraulic fracturestressneutron scatteringvulcan beamline

Kilauea Magnetotelluric Dataset

Jun 16, 2022
1.21 MB
Publicly accessible
In 2002 and 2003 a collaborative effort was undertaken between Lawrence Berkeley National Laboratory, Sandia National Laboratories, the USGS Menlo Park, the USGS Hawaiian Volcano Observatory, and Electromagnetic Instruments Inc. to study the Kilauea volcano in Hawaii using the mag...
Authors
Hoversten, G. and Gasperikova, E. Lawrence Berkeley National Laboratory
geothermalenergymtkilaueamagnetotelluricimpedance tensorsstationsremote sensingprocessed dataeast rift zoneerzhawaiivolcanoresistancelavamagmamagma reservoirsimpedanceelectrical contact resistance

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Brady's Geothermal Field DAS Earthquake Data

Mar 21, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the vibration caused by a 3.4 M earthquake and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. Data is available in the original .sgy formats, as well as in standardized .h5 formats. Earthquake information : M ...
Authors
Feigl, K. University of Wisconsin
geothermalbrady hot springsporotomoseismicdistributed acoustic sensingearthquakedashorizontalverticalgeophysicsmonitoringseismicityarraypassive sourcenveqinduced seismicityseg-yhdf5

Brady's Geothermal Field Nodal Seismometers Metadata

Mar 28, 2016
279.97 MB
Publicly accessible
Metadata for the nodal seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing. Metadata includes location and timing for each instrument as well as file lists of data to be uploaded in a separate submission.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatanodalseismometersporotomobradys geothermal areaseismicarraymonitoringseismicitygeophysics

Granite Springs Valley, Nevada Play Fairway Analysis Well data and Temperature Survey

Sep 14, 2017
12.18 MB
Publicly accessible
This data is associated with the Nevada Play Fairway project and includes excel files containing raw 2-meter temperature data and corrections. GIS shapefiles and layer files contain ing location and attribute information for the data are included. Well data includes both deep and ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergy2 meter temperature datanevadagranite springs valleyshapefilearcgisshape filelayer filelayerfilegisgeospatial datashallow temperature surveywell datageochemistryrock chemistrynv great basin

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

Utah FORGE: Laboratory Shear Experiments Linking Fault Roughness, Friction, Permeability, and P-Wave Characteristics

Aug 20, 2025
23.22 GB
Publicly accessible
This dataset contains results from five laboratory shear experiments on gneiss and granitoid samples from the Utah FORGE site, conducted at Penn State University. The experiments investigate links between fault surface roughness, frictional behavior, permeability, and P-wave acous...
Authors
Eijsink, A. et al Pennsylvania State University
geothermalenergyfrictionroughnessutah forgeegslaboratory datamodeled datashear experimentsfault mechanicspermeabilityp-waveacoustic transmissivityfault roughnessrate-and-state frictionbiaxial deformationgneissgranitoidoptical profilometrykeyencersfit3000mechanical dataacoustic datafault zone propertiesgeomechanicsrock physicsgeothermal reservoir characterization

Raw Pressure Data from Observation Wells at Brady's Hot Springs

Mar 13, 2016
5.15 MB
Publicly accessible
This .csv files contain the raw water pressure data from three observation wells during pumping tests performed in the Spring of 2016. Included is a "read me" file explaining the details of where and how the data were collected.
Authors
Lim, D. University of Wisconsin
geothermalpressure sensorpressurebrady hot springsobservation wellspumping testspressure datawater pressureread me fileobservation wellporotomobradys geothermal area

EGS Collab Experiment 2: Distributed Fiber Optic Temperature Data (DTS)

Nov 08, 2022
2.77 GB
Publicly accessible
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. Distributed fiber optic sensing temperature data is included in this dataset for this experiment. A single loop of custom fiber package was grouted into ...
Authors
Rodriguez Tribaldos, V. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdfosfiber opticxt-dtstemperaturedtsexperiment 2distributed sensingmonitoringcharacterization

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Google Earth Locations of USA and Seafloor Hydrothermal Vents with Associated Rare Earth Element Data

Feb 10, 2016
10.61 kB
Publicly accessible
Google Earth .kmz files that contain the locations of geothermal wells and thermal springs in the USA, and seafloor hydrothermal vents that have associated rare earth element data. The file does not contain the actual data, the actual data is available through the GDR website in t...
Authors
Fowler, A. University of California
geothermalreeseafloorusahydrothermallocationsgoogle earthrare earth elementshydrothermal ventthermal springsgeothermal springsrare earth elementfluidmormid ocean ridgegeospatialgeospatial data

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Project HOTSPOT: Kimama Well Borehole Geophysics Database

Jul 04, 2011
554.23 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
yellowstone hotspotidahosnake river plainproject hotspotborehole geophysicsgeothermalkimamapressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeopysicsneutronresistivityimage logsrpdownhole geophysicstemperatureboreholewell data

Validation of Innovative Exploration Technologies for Newberry Volcano: Raw Seismic Data

Jan 01, 2012
Size unavailable
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Seismic data raw taken by Apex Hipoint for 1st test 2012 (data in .ff format)
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalseismic datanewberryoregonvolcanocalderainnovative exploration technologiesseismicraw dataietgeophysicsrawdataexplorationhydrothermalegs

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Utah FORGE: Pump and Probe Test on an Intact Westerly Granite Sample

May 21, 2024
3.95 GB
Publicly accessible
This dataset contains results from a pump and probe experiment conducted on an intact Westerly Granite sample with a diameter of 1 inch and a height of 1 3/8 inches. The experiment was performed within an aluminum triaxial pressure vessel (TEMCO) to investigate the non-linear acou...
Authors
Klinghammer, H. et al Pennsylvania State University
utahtriaxialacousticsexperimentconfiningaxialprobingtransducerverasonicstemcoraw datalvdtpump and probegeomechanicsgeophysicswesterly graniteaxial pressure
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service