OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 22 of 22.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Trace element geochemistry"×
Other×

Google Earth Locations of USA and Seafloor Hydrothermal Vents with Associated Rare Earth Element Data

Feb 10, 2016
10.61 kB
Publicly accessible
Google Earth .kmz files that contain the locations of geothermal wells and thermal springs in the USA, and seafloor hydrothermal vents that have associated rare earth element data. The file does not contain the actual data, the actual data is available through the GDR website in t...
Authors
Fowler, A. University of California
geothermalreeseafloorusahydrothermallocationsgoogle earthrare earth elementshydrothermal ventthermal springsgeothermal springsrare earth elementfluidmormid ocean ridgegeospatialgeospatial data

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Large Scale Grid

Feb 26, 2021
248.07 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modeling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, on ...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcesimulationflowcfdflow simulationmodelreservoir coolinginjectionreservoir cooling systemaquifer storage cooling systemgroundground coolinggeothermal coolingreservoirnew jerseystockton universitywithdrawalfea

An HPC-Based Hydrothermal Finite Element Simulator for Modeling Underground Geothermal Behavior with Example Simulations on The Treasure Island and UC Berkeley Campus

Aug 01, 2021
186.08 MB
Publicly accessible
This submission contains the source code of the Hydrothermal Finite Element Simulator used for the Treasure Island and UC Berkeley campus geothermal simulation. It contains a report that summarizes the development and validation of this Hydrothermal Finite Element Simulator, with ...
Authors
Chen, K. et al Lawrence Berkeley National Laboratory
geothermalenergyfinite elementcoupled hydrothermal modelingcommunity scaleground source heat pumpparallel computingdeal.iidistrict heating and cooling systemsubsurface heat responsetreasure islanduc berkeley campuscsimulationuc berkeleydistrict heatingdistrict coolingenergy deliverygeothermal storagegoethermal energy storageenergy storage

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Granite Springs Valley, Nevada Play Fairway Analysis Well data and Temperature Survey

Sep 14, 2017
12.18 MB
Publicly accessible
This data is associated with the Nevada Play Fairway project and includes excel files containing raw 2-meter temperature data and corrections. GIS shapefiles and layer files contain ing location and attribute information for the data are included. Well data includes both deep and ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergy2 meter temperature datanevadagranite springs valleyshapefilearcgisshape filelayer filelayerfilegisgeospatial datashallow temperature surveywell datageochemistryrock chemistrynv great basin

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Summary of Geothermal Resources in the United States: GEOTHERM Data Set 1983

Apr 29, 1983
5.88 MB
Curated
The principal task of GEOTHERM is to provide information and research support for the conduct of national geothermal-resource assessments. The principal users of GEOTHERM are those involved with the Geothermal Research Program of the U.S. Geological Survey. These data include a pa...
Authors
Bliss, J. and Rapport, A. United States Geological Survey
geothermdatabasesoftwaregeothermal systemsusgsgeothermal wellswell characteristicshydrologygeochemistrydatabasesgeothermal fluidsreportscannedjournal articlecomputers and geosciencesgeospatial datapotentialgeothermal potentialgeology

Cascades/Aleutian Play Fairway Analysis: Data and Map Files

Nov 15, 2015
1.44 GB
Publicly accessible
Contains Excel data files used to quantifiably rank the geothermal potential of each of the young volcanic centers of the Cascade and Aleutian Arcs using world power production volcanic centers as benchmarks. Also contains shapefiles used in play fairway analysis with power plant...
Authors
Shevenell, L. ATLAS Geosciences Inc
geothermalworld volcanic centersplay fairwaycascadesaleutianspfaplay fairway analysisgis datamap datamap packagegeochemistrygeothermometryspringswellsfumarolessurface areapower plantsmw capacitiessurface areasvolcanic ventsrock typevolcanic centersstructural characteristicstectonic settingshapefilesaleutiangeochemsitry datastructural datageospatial data

GIS Resource Compilation Map Package Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
831.16 MB
Publicly accessible
This submission contains an ESRI map package (.mpk) with an embedded geodatabase for GIS resources used or derived in the Nevada Machine Learning project, meant to accompany the final report. The package includes layer descriptions, layer grouping, and symbology. Layer groups incl...
Authors
Brown, S. et al Nevada Bureau of Mines and Geology
geothermalenergynevadamachine learningmap packagegispcanmfbnnannelmgeochemistrygeophysicsheat flowslip and dilationstructureplay fairwaypfaexplorationcharacterizationgreat basindlipdilationgeodatabasehydrothermaldatamodelsprocessed datapaleo-geothermal featurestest sittessupervisedunsupervisedcultural

Hot Pot: Mercury Concentration Map

Jun 28, 2013
64.3 kB
Curated
Location of sample points and analytical results for mercury concentrations from a soil survey.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeochemistrysoil surveymercurymap packagegisgeospatial data

Chlorite Dissolution Kinetics at Variable pH and Temperatures up to 275C

Oct 01, 2013
3.11 MB
Publicly accessible
FY13 annual report describing the calculations and results associated with the data and dissolution rate contained in "Chlorite Kinetic Dissolution Data and Rate" (linked below).
Authors
Carroll, S. and Smith, M. Lawrence Livermore National Laboratory
geothermalchloritedissolutionkineticsgeochemistrydissolution ratereportchemical alterationegs

LiDAR, Granite Springs Valley, Nevada Play Fairway Analysis

Sep 14, 2017
15.31 GB
Publicly accessible
This data is associated with the Nevada Play Fairway project and contains the entire package of LiDAR data for Granite Springs Valley.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergylidarremote sensinghillshadenvnevadagranite springs valleyslopepfaplay fairway analysisbare-earthgisarcgislayer packagegeospatial datagsvnv great basin

New Mexico Play Fairway Analysis: Particle Tracking ArcGIS Map Packages

Nov 15, 2015
338.97 MB
Publicly accessible
These are map packages used to visualize geochemical particle-tracking analysis results in ArcGIS. It includes individual map packages for several regions of New Mexico including: Acoma, Rincon, Gila, Las Cruces, Socorro and Truth or Consequences.
Authors
Pepin, J. New Mexico Institute of Mining and Technology
geothermalparticle trackinggeochemistryboronlithiumnew mexicoacomagilarinconlas crucessocorrotruth or consequencest or cmap packagearcgisgisgeospatial datampknmpfaflow modelingheat flowadvectiveestimation

Fallon FORGE: Well Log Database

Jul 03, 2018
331.25 MB
Publicly accessible
Master well database for all logs and other well data pertaining to the Fallon FORGE site. Tables are formatted in NGDS Teir 3 schema where appropriate; redundancies between tables are omitted, and should be queried off of the main WellHeader table. All relationships are set on th...
Authors
Blankenship, D. Sandia National Laboratories
geothermalenergyfallonnevadaforgeegslogswell datawell loggeophysicsgeologygeochemistryrock propertieslithologywelllogcorecuttingsfracturesboreholeaqueous chemistrychemistryrockdensitynaturalinducedmagnetic susceptibilitypressuretemperaturespinnerptswireline

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Curated
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Project HOTSPOT: Mountain Home Well Borehole Geophysics Database

Nov 11, 2012
209.37 MB
Curated
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainproject hotspotidahoyellowstone hotspotborehole geophysicsmountain homegeophysicsborehole logdowhnhole geophysicstemperaturepressuregamma raymagnetic susceptibilitygeochemistrythoriumuraniumpotassiumneutronresistivityimage logsrpboreholewell data

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Curated
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service