OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 39.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"flow rates"×
Other×

Utah FORGE: Pump and Probe Test on an Intact Westerly Granite Sample

May 21, 2024
3.95 GB
Publicly accessible
This dataset contains results from a pump and probe experiment conducted on an intact Westerly Granite sample with a diameter of 1 inch and a height of 1 3/8 inches. The experiment was performed within an aluminum triaxial pressure vessel (TEMCO) to investigate the non-linear acou...
Authors
Klinghammer, H. et al Pennsylvania State University
utahtriaxialacousticsexperimentconfiningaxialprobingtransducerverasonicstemcoraw datalvdtpump and probegeomechanicsgeophysicswesterly graniteaxial pressure

Utah FORGE: Pump and Probe Test on a Mated Fracture Westerly Granite Sample

May 19, 2024
4.45 GB
Publicly accessible
This dataset contains results from a pump and probe experiment conducted on a mated fracture Westerly Granite sample with a diameter of 1 inch and a height of 2 7/8 inches. The experiment was performed within an aluminum triaxial pressure vessel (TEMCO) to investigate the non-line...
Authors
Klinghammer, H. et al Pennsylvania State University
utahforgeexperimentraw datatransduceracousticswesterlygraniteverasonicsaxialconfiningtriaxialtemcolvdtpump and probegeomechanicsgeophysicswesterly granitemated fractureaxial pressure

Subsurface Characterization and Machine Learning Predictions at Brady Hot Springs Results

Oct 20, 2021
6.41 MB
Publicly accessible
Geothermal power plants typically show decreasing heat and power production rates over time. Mitigation strategies include optimizing the management of existing wells increasing or decreasing the fluid flow rates across the wells and drilling new wells at appropriate locations. Th...
Authors
Beckers, K. et al National Renewable Energy Laboratory
geothermalenergymachine learningmlsubsurfacecharacterizationbrady hot springsbhspredictionreservoir modelingtime seriespcaprincipal component analysisreservoir managementreservoirdual-porositystimulationinjection testpdetemperatureflowpressuresimulationsingle-fracturedoubletheat maptensorflowcnnlstmmlphydrothermalopen source reservoirosrnevada

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
1.27 GB
Publicly accessible
The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal energy production. Phase 1 includes reservoir analyses to determine injector/producer well schemes that balance the generation of economically useful flow rates at the ...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageco2 injectionpressure managmentpressure supportartesian well flowheat extractionco2 cutpressure management

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
475.12 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk : FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageco2 injectionheat extractionpressure managmentpressure supportartesian well flowco2 cutsedimentarypressure managementworking fluid

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
979.58 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk : FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportco2 injectionartesian well flowheat extractionco2 cutsedimentarybrine reinjection

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas

Jun 28, 2018
20.79 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texastravis peaksabine uplifthosstonsligocotton valleylongvieweastman chemicalreservoir productivity indexrpiheatflowheat flowsmusouthern methodist universitynrelbottom hole temperaturebhtabsorption chillpresentationmemodatapaperpublicationjournal articleddutxfeasibilitydeep direct-use

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2000
609.93 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storageheat extractionpressure managementpressure supportartesian well flowco2 cutworking fluidco2 injection

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Large Scale Grid

Feb 26, 2021
248.07 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modeling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, on ...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcesimulationflowcfdflow simulationmodelreservoir coolinginjectionreservoir cooling systemaquifer storage cooling systemgroundground coolinggeothermal coolingreservoirnew jerseystockton universitywithdrawalfea

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Fallon FORGE: Geodetic Data

Feb 01, 2018
335.78 MB
Publicly accessible
Fallon FORGE InSAR and geodetic GPS deformation data. InSAR shapefiles are packaged together as .MPK (ArcMap map package, compatible with other GIS platforms), and as .CSV comma-delimited plaintext. GPS data and additional metadata are linked to the Nevada Geodetic Laboratory data...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyfallonforgeegsinsargeodeticsgpsphase 2bnevadavetted-nonvinterferometricsynthetic aperture radargeodesyremote sensingdeformationgeospatial data

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
34.45 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal ...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportworking fluidheat extractionco2 cutsedimentary

Snake River Plain Geothermal Play Fairway Analysis Project Active Source Seismic Data

Sep 30, 2018
5.99 GB
Publicly accessible
This archive contains seismic shot field records for 10 profiles located in Camas Prairie, Idaho. The eight numbered .sgy files were acquired using a seismic land streamer system with an accelerated weight drop source and 72 geophones. These 10-Hz geophones were mounted on base pl...
Authors
Liberty, L. and Shervais, J. Boise State University
geothermalenergypfaplay fairway analysisidahosrpsnake river plainseismicactive sourcedatageophysicsmapsurveygeophysicalcamasprairiesgygeologytopographyaerialgeologictopographicfairfield

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

Stanford Thermal Earth Model for the Conterminous United States

Mar 14, 2024
21.57 GB
Publicly accessible
Provided here are various forms of the Stanford Thermal Earth Model, as well as the data and methods used for its creation. The predictions produced by this model were visualized in two-dimensional spatial maps across the modeled depths (0-7 km) for the conterminous United States....
Authors
Aljubran, M. and Horne, R. Stanford University
thermal earth modeltemperaturegeothermalenergystanfordtemperature-at-depthheat flowrock thermal conductivityinterpignnphysics-informedgraph neural networksmachine learningmodeltemperature modelarcgisapimodel inputsmodel outputsdata-drivenspatial interpolationalgorithmheat conductionbottomhole temperature

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation

New Mexico Play Fairway Analysis: Particle Tracking ArcGIS Map Packages

Nov 15, 2015
338.97 MB
Publicly accessible
These are map packages used to visualize geochemical particle-tracking analysis results in ArcGIS. It includes individual map packages for several regions of New Mexico including: Acoma, Rincon, Gila, Las Cruces, Socorro and Truth or Consequences.
Authors
Pepin, J. New Mexico Institute of Mining and Technology
geothermalparticle trackinggeochemistryboronlithiumnew mexicoacomagilarinconlas crucessocorrotruth or consequencest or cmap packagearcgisgisgeospatial datampknmpfaflow modelingheat flowadvectiveestimation

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Cascades/Aleutian Play Fairway Analysis: Data and Map Files

Nov 15, 2015
1.44 GB
Publicly accessible
Contains Excel data files used to quantifiably rank the geothermal potential of each of the young volcanic centers of the Cascade and Aleutian Arcs using world power production volcanic centers as benchmarks. Also contains shapefiles used in play fairway analysis with power plant...
Authors
Shevenell, L. ATLAS Geosciences Inc
geothermalworld volcanic centersplay fairwaycascadesaleutianspfaplay fairway analysisgis datamap datamap packagegeochemistrygeothermometryspringswellsfumarolessurface areapower plantsmw capacitiessurface areasvolcanic ventsrock typevolcanic centersstructural characteristicstectonic settingshapefilesaleutiangeochemsitry datastructural datageospatial data

Investigation of Stimulation-Response Relationships for Complex Fracture Systems in Enhanced Geothermal Reservoirs

Jan 01, 2011
7.34 MB
Publicly accessible
Hydraulic fracturing is currently the primary method for stimulating low-permeability geothermal reservoirs and creating Enhanced (or Engineered) Geothermal Systems (EGS) with improved permeability and heat production efficiency. Complex natural fracture systems usually exist in ...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalenhanced geothermal systemegsdiscrete fracture flowmodelingreservoir stimulationstimulationhydraulic fracturing

GIS Resource Compilation Map Package Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
831.16 MB
Publicly accessible
This submission contains an ESRI map package (.mpk) with an embedded geodatabase for GIS resources used or derived in the Nevada Machine Learning project, meant to accompany the final report. The package includes layer descriptions, layer grouping, and symbology. Layer groups incl...
Authors
Brown, S. et al Nevada Bureau of Mines and Geology
geothermalenergynevadamachine learningmap packagegispcanmfbnnannelmgeochemistrygeophysicsheat flowslip and dilationstructureplay fairwaypfaexplorationcharacterizationgreat basindlipdilationgeodatabasehydrothermaldatamodelsprocessed datapaleo-geothermal featurestest sittessupervisedunsupervisedcultural

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service