OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 169.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"levelized cost of heat LCOH"×
Other×

Dataset for report: Non-Technical Barriers to Geothermal Development in California and Nevada

Mar 10, 2022
66.68 MB
Publicly accessible
In California and Nevada, geothermal projects are subject to non-technical barriers, which may create development delays leading to higher project costs and risks and decreased competitiveness with other electricity generation technologies. These non-technical barriers may include...
Authors
Levine, A. et al National Renewable Energy Laboratory
geothermalenergycalifornianevadasalton searegulatorybarriersnon-technicalinterviewsenvironmentalstakeholdersnon-technical barriersntbgeoreportseatpermitenvironmental reviewauthorizationseconomiclcoecostfeasibilityprocessed dataannual technology baselineatbimperial countychurchill county

GeoVision: Harnessing the Heat Beneath Our Feet Analysis Inputs and Results

Sep 30, 2019
29.51 MB
Publicly accessible
This submission includes input and results data from analysis done as part of the Geothermal Technology Office's Geothermal Vision Study (GeoVision). The submission includes data for both analysis of the electricity sector and the heating and cooling sector. For the electricity se...
Authors
Geothermal Technologies Office, U. National Renewable Energy Laboratory
geothermalenergygeovisionreeds modeldgeo modelfuture scenariosresource potentialcapacity expansionmodelingsystems analysisghpground source heat pumpgeothermal conductivitygeographic information systemgisgtcdistributed energy resourcesdersdistributed geothermal market demand modelnrelregional energy deployment systemrenewable analysiswater use analysissupply curve inputselectricity sectorair quality impactswater impacts

GHPsRUS: Geothermal Heat Pump Employment and Installation Price Data

Jul 09, 2013
5.55 MB
Publicly accessible
The GHPsRUS Project's full name is "Measuring the Costs and Benefits of Nationwide Geothermal Heat Pump Deployment." The dataset contains employment and installation price data collected by four economic surveys: (1)GHPsRUS Project Manufacturer & OEM Survey, (2) GHPsRUS Project G...
Authors
Battocletti, L. Bob Lawrence and Associates, Inc.
geothermalgeothermal heat pumploop installation pricemechanical equipment installation priceemploymentgeographic locationmanufacturersindustryghpcost-benefit

Geothermal Electricity Technology Evaluation Model (GETEM) Individual Case Files and Summary Spreadsheet (GETEM version Spring 2013)

Mar 07, 2013
54.02 MB
Publicly accessible
This group of files includes 10 GETEM individual scenario files and 1 summary spreadsheet. Each spreadsheet contains final data (following the revisions made between summer of 2011 and spring of 2013).
Authors
Entingh, D. et al Idaho National Laboratory
geothermalgetemgeothermal electricity technology evaluation modellevelized cost of electricitylcoe

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
34.45 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal ...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportworking fluidheat extractionco2 cutsedimentary

Global Value Chain and Manufacturing Analysis on Geothermal Power Plant Turbines

Mar 30, 2018
4.93 MB
Publicly accessible
In this study, we have undertaken a robust analysis of the global supply chain and manufacturing costs for components of Organic Rankine Cycle (ORC) Turboexpander and steam turbines used in geothermal power plants. We collected a range of market data influencing manufacturing from...
Authors
Akar, S. et al National Renewable Energy Laboratory
geothermalenergymanufacturingturboexpanderorcsteam turbinevalue chainpower plantclean energy manufacturing analysis center

Alternative CAES Technology Using Depleted Unconventional Gas Wells and Subsurface Thermal Energy Storage (GeoCAES)

May 23, 2019
413.08 kB
Publicly accessible
This project assessed the technical viability of a process called GeoCAES. The process stores electrical energy by injecting natural gas into shale gas formations using a compressor, storing it, and producing it through an expander to generate electricity. This data submission inc...
Authors
Johnston, H. and Young, D. National Renewable Energy Laboratory
geothermalenergyenergy storagenatural gasunconventional shalegeocaesmodelwellgeothermal energy storagegeothermal reservoirsurface plantfeasibilitytechnologytestechnicaltechnical assesmentcodeprocessed data

Community Geothermal: Energy, Cost, and Carbon Modeling for District Design Ann Arbor, MI

Jan 01, 2024
410.48 MB
Publicly accessible
This data includes results on an analysis of existing and projected energy, cost, and carbon for the City of Ann Arbor District Geothermal Design and Deployment to Equitably Decarbonize Low Income Neighborhoods in Ann Arbor project. The scope of the project includes designing and ...
Authors
Lee, J. and McMillen, A. IMEG Corp
geothermalenergyenergy plusdesign buildermichigancommunity geothermaldistrict geothermalcommgeoann arborheating and coolingenergy loadenergy modelcostcarbonbenchmarkingprocessed dataload timeseriesmodelresstockeconomicenvironmentalassessmentenergy auditbuilding modelingdevelopment

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

OM300 Direction Drilling Module

Aug 22, 2013
39.67 kB
Publicly accessible
OM300 Geothermal Direction Drilling Navigation Tool A prototype directional drilling navigation tool capable of high temperature operation in geothermal drilling with: Accuracies of 0.1 degree Inclination and Tool Face, 0.5 degree Azimuth Environmental Ruggedness typical of existi...
Authors
MacGugan, D. Honeywell International, Inc.
geothermaldirectional drillingsoinavigationhigh temperatureelectronicsmodulesilicon-on-insulatordata archive

Using Fully Coupled Hydro-Geomechanical Numerical Test Bed to Study Reservoir Stimulation with Low Hydraulic Pressure

Jan 31, 2012
6.63 MB
Publicly accessible
This paper documents our effort to use a fully coupled hydro-geomechanical numerical test bed to study using low hydraulic pressure to stimulate geothermal reservoirs with existing fracture network. In this low pressure stimulation strategy, fluid pressure is lower than the minimu...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalreservoir modelinghydraulic shearinghydraulic fracturingfracturereservoir stimulationlow pressurestimulation

G-Function Library for Modeling Vertical Bore Ground Heat Exchanger

Jun 30, 2021
234.14 MB
Publicly accessible
This library contains g-functions (thermal response functions) for standard, regularly spaced vertical borehole ground heat exchangers. In total, it contains 34, 321 configurations. To permit interpolation, each configuration has g-functions for heights of 24, 48, 96, 192, and 384...
Authors
Spitler, J. et al Oak Ridge National Laboratory
geothermalenergyheat pumpground heat exchangerg-functionlibrarythermal response functionssimulationground heat pumpghpmodelheat exchanger

Microhole drilling technology utilizing a golden section search algorithm

Jun 23, 2021
812.35 MB
Publicly accessible
A fundamental issue in microhole drilling is that delivering high weight-on-bit (WOB), high torque rotational horsepower to a conventional drill bit does not scale down to the hole sizes necessary to realize the envisioned cost savings An optimization algorithm called a golden sec...
Authors
Su, J. et al Sandia National Laboratories
geothermalpercussive hammerweight-on-bitoptimizationmicroholesslimholesdrillingexplorationmonitoringtechnical assessmentfeasibilitywobgssgolden section searchalgorithmblue canyon domenew mexico tech energetic materials research and testing centersocorronew mexico

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Lancaster County Adult Detention Facility Geothermal Well Field Configuration

Feb 24, 2009
3.39 MB
Publicly accessible
Drawing showing the configuration of 667 bore holes drilled to depth of 300 ft. for the Lancaster County Adult Detention Facility geothermal heat pump system.
Authors
Davlin, T. District Energy Corporation
geothermalground source heat pumpgeothermal heat pumpghpsite maptopographiclancaster countyadult detention facilitylincolnnebraska

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas

Jun 28, 2018
20.79 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texastravis peaksabine uplifthosstonsligocotton valleylongvieweastman chemicalreservoir productivity indexrpiheatflowheat flowsmusouthern methodist universitynrelbottom hole temperaturebhtabsorption chillpresentationmemodatapaperpublicationjournal articleddutxfeasibilitydeep direct-use

Stanford Thermal Earth Model for the Conterminous United States

Mar 14, 2024
21.57 GB
Publicly accessible
Provided here are various forms of the Stanford Thermal Earth Model, as well as the data and methods used for its creation. The predictions produced by this model were visualized in two-dimensional spatial maps across the modeled depths (0-7 km) for the conterminous United States....
Authors
Aljubran, M. and Horne, R. Stanford University
thermal earth modeltemperaturegeothermalenergystanfordtemperature-at-depthheat flowrock thermal conductivityinterpignnphysics-informedgraph neural networksmachine learningmodeltemperature modelarcgisapimodel inputsmodel outputsdata-drivenspatial interpolationalgorithmheat conductionbottomhole temperature

September 2014 Dixie Valley DOE Production Data

Sep 30, 2014
482.03 kB
Publicly accessible
Binary Engineering production data. Used to demonstrate the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant.
Authors
Lee, V. Terra-Gen Sierra Holdings, LLC
geothermaldixie valley binary systembottoming cycleproduction databianrybinary power plantbrineunused heatbottomingbinary cyclenevadalow temperature

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk

Applications of Geothermally-Produced Colloidal Silica in Reservoir Management Smart Gels

Jan 31, 2013
3.56 MB
Publicly accessible
In enhanced geothermal systems (EGS) the reservoir permeability is often enhanced or created using hydraulic fracturing. In hydraulic fracturing, high fluid pressures are applied to confined zones in the subsurface usually using packers to fracture the host rock. This enhances r...
Authors
Hunt, J. et al Lawrence Livermore National Laboratory
geothermalzonal isolationreservoir managementfluid diversioncolloidal silicasilicacoproduction

August 2014 Dixie Valley DOE Production Data

Aug 31, 2014
482.03 kB
Publicly accessible
Binary Engineering production data for August 2014. Used to demonstrate the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant.
Authors
Lee, V. Terra-Gen Sierra Holdings, LLC
geothermaldixie valleybinary systembottoming cyclebinaryproduction databinary power plantbrineunused heatbottomingbinary cyclenevadalow temperature

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

An HPC-Based Hydrothermal Finite Element Simulator for Modeling Underground Geothermal Behavior with Example Simulations on The Treasure Island and UC Berkeley Campus

Aug 01, 2021
186.08 MB
Publicly accessible
This submission contains the source code of the Hydrothermal Finite Element Simulator used for the Treasure Island and UC Berkeley campus geothermal simulation. It contains a report that summarizes the development and validation of this Hydrothermal Finite Element Simulator, with ...
Authors
Chen, K. et al Lawrence Berkeley National Laboratory
geothermalenergyfinite elementcoupled hydrothermal modelingcommunity scaleground source heat pumpparallel computingdeal.iidistrict heating and cooling systemsubsurface heat responsetreasure islanduc berkeley campuscsimulationuc berkeleydistrict heatingdistrict coolingenergy deliverygeothermal storagegoethermal energy storageenergy storage

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

University of Illinois Campus Deep Direct-Use Feasibility Study Long-Term Meteorological Data

Mar 30, 2018
74.24 MB
Publicly accessible
This submission includes meteorological data recorded by National Weather Service at University of Illinois Willard Airport, Savoy IL for period 1972 to 2018. This data is for use in parameterizing the demand and life-cycle assessments associated with the project, and provides inf...
Authors
Lin, Y. University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoismeteorologicalwillard airportnational weather serviceweather
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service