OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 154.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"magnetotelluric data"×
Other×

Kilauea Magnetotelluric Dataset

Jun 16, 2022
1.21 MB
Publicly accessible
In 2002 and 2003 a collaborative effort was undertaken between Lawrence Berkeley National Laboratory, Sandia National Laboratories, the USGS Menlo Park, the USGS Hawaiian Volcano Observatory, and Electromagnetic Instruments Inc. to study the Kilauea volcano in Hawaii using the mag...
Authors
Hoversten, G. and Gasperikova, E. Lawrence Berkeley National Laboratory
geothermalenergymtkilaueamagnetotelluricimpedance tensorsstationsremote sensingprocessed dataeast rift zoneerzhawaiivolcanoresistancelavamagmamagma reservoirsimpedanceelectrical contact resistance

Play Fairway Analysis CA-NV-OR: Medicine Lake 2km MT

Aug 05, 2015
6.14 kB
Publicly accessible
Magnetotelluric (MT) data for Medicine lake with 2km grid.
Authors
M, C. University of California
geothermalmagnetotelluricmedicine lakemtpfaresistivityconductivitycaliforniacaca-nv-orplay fairway analysisexplorationcharacterizationgeophysics

West Flank Coso FORGE: Magnetotelluric 3D Data

Jan 01, 2016
10.66 MB
Publicly accessible
This is the 3D version of the MT data for the West Flank Coso FORGE area. The Coso geothermal field has had three Magnetotelluric (MT) datasets collected including surveys in 2003, 2006, and 2011. The final collection, in 2011, expanded the survey to the west and covers the West F...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegswest flankforgecaliforniamtgeophysicsinversionmagnetotelluricssurveycoso

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Snake River Plain Geothermal Play Fairway Analysis Project MT Data

May 06, 2018
12.02 MB
Publicly accessible
MT is measured in the field by using induction coils to measure the time-varying magnetic source for frequencies between 1000-0.001~Hz, and electric dipoles to measure the Earth's electrical response. Because the magnetic source field is polarized, orthogonal directions of the f...
Authors
Peacock, J. et al United States Geological Survey
geothermalenergysnake river plainpfaplay fairway analysisidahocamasprairiemagnetotelluricsmtdataresistivityconductivityelectricalgeophysicsgeophysicalsrp

Raw Neutron Scattering Data for Strain Measurement of Hydraulically Loaded Granite and Marble Samples in Triaxial Stress State

May 23, 2014
22.11 MB
Publicly accessible
This entry contains raw data files from experiments performed on the Vulcan beamline at the Spallation Neutron Source at Oak Ridge National Laboratory using a pressure cell. Cylindrical granite and marble samples were subjected to confining pressures of either 0 psi or approximate...
Authors
Polsky, Y. Oak Ridge National Laboratory
geothermalneutronstrainhydraulic fracturingegsdiffractiongranitemarbletriaxialhydraulic fracturestressneutron scatteringvulcan beamline

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Curated
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Brady's Geothermal Field DAS Earthquake Data

Mar 21, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the vibration caused by a 3.4 M earthquake and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. Data is available in the original .sgy formats, as well as in standardized .h5 formats. Earthquake information : M ...
Authors
Feigl, K. University of Wisconsin
geothermalbrady hot springsporotomoseismicdistributed acoustic sensingearthquakedashorizontalverticalgeophysicsmonitoringseismicityarraypassive sourcenveqinduced seismicityseg-yhdf5

Brady's Geothermal Field Nodal Seismometers Metadata

Mar 28, 2016
279.97 MB
Publicly accessible
Metadata for the nodal seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing. Metadata includes location and timing for each instrument as well as file lists of data to be uploaded in a separate submission.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatanodalseismometersporotomobradys geothermal areaseismicarraymonitoringseismicitygeophysics

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Granite Springs Valley, Nevada Play Fairway Analysis Well data and Temperature Survey

Sep 14, 2017
12.18 MB
Publicly accessible
This data is associated with the Nevada Play Fairway project and includes excel files containing raw 2-meter temperature data and corrections. GIS shapefiles and layer files contain ing location and attribute information for the data are included. Well data includes both deep and ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergy2 meter temperature datanevadagranite springs valleyshapefilearcgisshape filelayer filelayerfilegisgeospatial datashallow temperature surveywell datageochemistryrock chemistrynv great basin

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

Utah FORGE: Laboratory Shear Experiments Linking Fault Roughness, Friction, Permeability, and P-Wave Characteristics

Aug 20, 2025
23.22 GB
Curated
This dataset contains results from five laboratory shear experiments on gneiss and granitoid samples from the Utah FORGE site, conducted at Penn State University. The experiments investigate links between fault surface roughness, frictional behavior, permeability, and P-wave acous...
Authors
Eijsink, A. et al Pennsylvania State University
geothermalenergyfrictionroughnessutah forgeegslaboratory datamodeled datashear experimentsfault mechanicspermeabilityp-waveacoustic transmissivityfault roughnessrate-and-state frictionbiaxial deformationgneissgranitoidoptical profilometrykeyencersfit3000mechanical dataacoustic datafault zone propertiesgeomechanicsrock physicsgeothermal reservoir characterization

Cascades/Aleutian Play Fairway Analysis: Data and Map Files

Nov 15, 2015
1.44 GB
Publicly accessible
Contains Excel data files used to quantifiably rank the geothermal potential of each of the young volcanic centers of the Cascade and Aleutian Arcs using world power production volcanic centers as benchmarks. Also contains shapefiles used in play fairway analysis with power plant...
Authors
Shevenell, L. ATLAS Geosciences Inc
geothermalworld volcanic centersplay fairwaycascadesaleutianspfaplay fairway analysisgis datamap datamap packagegeochemistrygeothermometryspringswellsfumarolessurface areapower plantsmw capacitiessurface areasvolcanic ventsrock typevolcanic centersstructural characteristicstectonic settingshapefilesaleutiangeochemsitry datastructural datageospatial data

Raw Pressure Data from Observation Wells at Brady's Hot Springs

Mar 13, 2016
5.15 MB
Publicly accessible
This .csv files contain the raw water pressure data from three observation wells during pumping tests performed in the Spring of 2016. Included is a "read me" file explaining the details of where and how the data were collected.
Authors
Lim, D. University of Wisconsin
geothermalpressure sensorpressurebrady hot springsobservation wellspumping testspressure datawater pressureread me fileobservation wellporotomobradys geothermal area

EGS Collab Experiment 2: Distributed Fiber Optic Temperature Data (DTS)

Nov 08, 2022
2.77 GB
Curated
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. Distributed fiber optic sensing temperature data is included in this dataset for this experiment. A single loop of custom fiber package was grouted into ...
Authors
Rodriguez Tribaldos, V. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdfosfiber opticxt-dtstemperaturedtsexperiment 2distributed sensingmonitoringcharacterization

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

Google Earth Locations of USA and Seafloor Hydrothermal Vents with Associated Rare Earth Element Data

Feb 10, 2016
10.61 kB
Publicly accessible
Google Earth .kmz files that contain the locations of geothermal wells and thermal springs in the USA, and seafloor hydrothermal vents that have associated rare earth element data. The file does not contain the actual data, the actual data is available through the GDR website in t...
Authors
Fowler, A. University of California
geothermalreeseafloorusahydrothermallocationsgoogle earthrare earth elementshydrothermal ventthermal springsgeothermal springsrare earth elementfluidmormid ocean ridgegeospatialgeospatial data

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service