OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 19 of 19.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"meso-scale stimulations"×
Other×

EGS Collab Experiment 1: Continuous Active-Source Seismic Monitoring (CASSM) Data

Apr 25, 2018
5.01 TB
Publicly accessible
The U.S. Department of Energy's Enhanced Geothermal System (EGS) Collab project aims to improve our understanding of hydraulic stimulations in crystalline rock for enhanced geothermal energy production through execution of intensely monitored meso-scale experiments. The first expe...
Authors
Schoenball, M. and Sprinkle, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsseismicactive sourceimagingmonitoringcassmcontinuousexperiment 1geophysicshydrophonegeophoneaccelerometerwell instrumentationmeso scale

EGS Collab Experiment 3: 4100 Tensile Stimulation and Thermal Circulation Testing

Aug 26, 2022
6.03 GB
Publicly accessible
These data and test descriptions are from a set of primarily tensile hydraulic-fracture stimulations in wells E2-TC and E2-TU and a subsequent chilled water circulation test conducted by injecting in well E2-TU on the 4100 level of the Sandford Underground Research Facility (SURF)...
Authors
Vermeul, V. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationexperimentegsflowflow testingwellinjectionproductiontensilee2-tce2-tucirculation tenstingexperiment 34100thermal circulationchilled water injectionraw datalogprocessed data

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

University of Illinois Campus Deep Direct-Use Feasibility Study Long-Term Meteorological Data

Mar 30, 2018
74.24 MB
Publicly accessible
This submission includes meteorological data recorded by National Weather Service at University of Illinois Willard Airport, Savoy IL for period 1972 to 2018. This data is for use in parameterizing the demand and life-cycle assessments associated with the project, and provides inf...
Authors
Lin, Y. University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoismeteorologicalwillard airportnational weather serviceweather

Microhole drilling technology utilizing a golden section search algorithm

Jun 23, 2021
812.35 MB
Publicly accessible
A fundamental issue in microhole drilling is that delivering high weight-on-bit (WOB), high torque rotational horsepower to a conventional drill bit does not scale down to the hole sizes necessary to realize the envisioned cost savings An optimization algorithm called a golden sec...
Authors
Su, J. et al Sandia National Laboratories
geothermalpercussive hammerweight-on-bitoptimizationmicroholesslimholesdrillingexplorationmonitoringtechnical assessmentfeasibilitywobgssgolden section searchalgorithmblue canyon domenew mexico tech energetic materials research and testing centersocorronew mexico

An HPC-Based Hydrothermal Finite Element Simulator for Modeling Underground Geothermal Behavior with Example Simulations on The Treasure Island and UC Berkeley Campus

Aug 01, 2021
186.08 MB
Publicly accessible
This submission contains the source code of the Hydrothermal Finite Element Simulator used for the Treasure Island and UC Berkeley campus geothermal simulation. It contains a report that summarizes the development and validation of this Hydrothermal Finite Element Simulator, with ...
Authors
Chen, K. et al Lawrence Berkeley National Laboratory
geothermalenergyfinite elementcoupled hydrothermal modelingcommunity scaleground source heat pumpparallel computingdeal.iidistrict heating and cooling systemsubsurface heat responsetreasure islanduc berkeley campuscsimulationuc berkeleydistrict heatingdistrict coolingenergy deliverygeothermal storagegoethermal energy storageenergy storage

DEEPEN 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jun 30, 2023
3.62 GB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. Part of the DEEPEN project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfamodellingmodelingcharacterizationexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponent

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Large Scale Grid

Feb 26, 2021
248.07 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modeling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, on ...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcesimulationflowcfdflow simulationmodelreservoir coolinginjectionreservoir cooling systemaquifer storage cooling systemgroundground coolinggeothermal coolingreservoirnew jerseystockton universitywithdrawalfea

Snake River Plain Geothermal Play Fairway Analysis Volcanic Vents, Lacustrine Sediments, and post-Miocene Faults KMZ files

Oct 10, 2015
2.19 MB
Publicly accessible
This dataset contain raw data files in kmz files (Google Earth georeference format). These files include volcanic vent locations and age, the distribution of fine-grained lacustrine sediments (which act as both a seal and an insulating layer for hydrothermal fluids), and post-Mioc...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysisgoogle earthkmzgeospatialdataccrsgeoreferencingvolcanicsventsedimentstructurepfageospatial dataphase 1srplacustrinesedimentsfaultsfaultventsvolcanicmuds

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Subsurface Characterization and Machine Learning Predictions at Brady Hot Springs Results

Oct 20, 2021
6.41 MB
Publicly accessible
Geothermal power plants typically show decreasing heat and power production rates over time. Mitigation strategies include optimizing the management of existing wells increasing or decreasing the fluid flow rates across the wells and drilling new wells at appropriate locations. Th...
Authors
Beckers, K. et al National Renewable Energy Laboratory
geothermalenergymachine learningmlsubsurfacecharacterizationbrady hot springsbhspredictionreservoir modelingtime seriespcaprincipal component analysisreservoir managementreservoirdual-porositystimulationinjection testpdetemperatureflowpressuresimulationsingle-fracturedoubletheat maptensorflowcnnlstmmlphydrothermalopen source reservoirosrnevada

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Curated
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Curated
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

Community Geothermal: Energy, Cost, and Carbon Modeling for District Design Ann Arbor, MI

Jan 01, 2024
410.48 MB
Publicly accessible
This data includes results on an analysis of existing and projected energy, cost, and carbon for the City of Ann Arbor District Geothermal Design and Deployment to Equitably Decarbonize Low Income Neighborhoods in Ann Arbor project. The scope of the project includes designing and ...
Authors
Lee, J. and McMillen, A. IMEG Corp
geothermalenergyenergy plusdesign buildermichigancommunity geothermaldistrict geothermalcommgeoann arborheating and coolingenergy loadenergy modelcostcarbonbenchmarkingprocessed dataload timeseriesmodelresstockeconomicenvironmentalassessmentenergy auditbuilding modelingdevelopment

Kilauea Magnetotelluric Dataset

Jun 16, 2022
1.21 MB
Publicly accessible
In 2002 and 2003 a collaborative effort was undertaken between Lawrence Berkeley National Laboratory, Sandia National Laboratories, the USGS Menlo Park, the USGS Hawaiian Volcano Observatory, and Electromagnetic Instruments Inc. to study the Kilauea volcano in Hawaii using the mag...
Authors
Hoversten, G. and Gasperikova, E. Lawrence Berkeley National Laboratory
geothermalenergymtkilaueamagnetotelluricimpedance tensorsstationsremote sensingprocessed dataeast rift zoneerzhawaiivolcanoresistancelavamagmamagma reservoirsimpedanceelectrical contact resistance
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service