OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 151 - 175 of 1449.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"Columbus Salt Marsh Geothermal Area"×

El Centro Fluid Inclusion Gas Analysis

Jan 01, 2013
1.31 MB
Publicly accessible
Fluid inclusion gas analysis for wells in El Centro geothermal area, California. Analyses used in developing fluid inclusion stratigraphy for wells and defining fluids across the geothermal fields. Each sample has mass spectrum counts for 180 chemical species.
Authors
Dilley, L. Hattenburg Dilley and Linnell
geothermalfluid inclusiongas analysisfluid inclusion stratigraphymass spectrometryimperial valleyel centrocalifornia

Hawthorne Fluid Inclusion Gas Analysis

Jan 01, 2013
1.2 MB
Publicly accessible
Fluid inclusion gas analysis for wells in the Hawthorne Army Ammunition Depot geothermal area, Nevada. Analyses used in developing fluid inclusion stratigraphy for wells and defining fluids across the geothermal fields. Each sample has mass spectrum counts for 180 chemical species.
Authors
Dilley, L. Hattenburg Dilley and Linnell
geothermalfluid inclusiongas analysisfluid inclusion stratigraphymass spectrometryhawthornegreat basinnevada

February 2014 Dixie Valley Binary Cycle Production Data Report

Mar 11, 2014
12.84 kB
Publicly accessible
Formal Report: Dixie Valley Binary DOE Report February 2014. Includes summary of data, operations, outages, and curtailments in order to support the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant f...
Authors
Brown, D. Terra-Gen Sierra Holdings, LLC
geothermaldixie valleyperformancebinary plantproduction reportsummarybinary cycleunused heatbinary power plantlow temperaturebrinebottomingwaste water

March 2014 Dixie Valley Binary Cycle Production Data Report

Mar 31, 2014
11.62 kB
Publicly accessible
Dixie Valley production data from March, 2014 Summary report of data, operations, outages, and curtailments in order to support the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant from the low-tempe...
Authors
Brown, D. Terra-Gen Sierra Holdings, LLC
geothermalbinarybeowawedixie valleyproduction databottoming cyclelow temperaturebrineunused heatbottomingbinary cycleproduction reportsummary

April 2014 Dixie Valley Binary Cycle Production Data Report

May 08, 2014
11.97 kB
Publicly accessible
DOE Report for binary unit. Includes summary of data, operations, outages, and curtailments in order to support the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant from the low-temperature brine at ...
Authors
Brown, D. Terra-Gen Sierra Holdings, LLC
geothermalbinary power plantproduction datadixie valley nevadabottoming cycleproduction reportsummarybinary cycleunused heatbinarylow temperaturebrinebottomingwaste water

August 2014 Dixie Valley DOE Production Data

Aug 31, 2014
482.03 kB
Publicly accessible
Binary Engineering production data for August 2014. Used to demonstrate the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant.
Authors
Lee, V. Terra-Gen Sierra Holdings, LLC
geothermaldixie valleybinary systembottoming cyclebinaryproduction databinary power plantbrineunused heatbottomingbinary cyclenevadalow temperature

Bradys Hot Springs Geothermal Area Build FEM Configuration

Jul 01, 2015
32.27 MB
Publicly accessible
This submission contains mesh information, nodal coordinates, connectivity data, and list of query points for the build FEM configuration.
Authors
Ali, T. University of Wisconsin
geothermalfemmeshnodal coordinatesrotated coordinatesconfigurationconnectivitygeologic database

The Use of 3D Geologic Modeling to Improve Well Targeting in Glass Buttes, Oregon

Oct 09, 2011
2.2 MB
Publicly accessible
The Glass Buttes Project includes combining a suite of high-resolution geophysical and geochemical techniques to reduce exploration risk by characterizing hydrothermal alteration, fault geometries and relationships. This is aided through geologic observation, modern remote sensing...
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicsgeochemistryexplorationlidarfault geometriesremote sensingstructural modelslim holesgeophysicalgeochemical3dgeologic modelinggeology

Effectiveness of Shallow Temperature Surveys to Target a Geothermal Reservoir at Previously Explored Site at McGee Mountain, Nevada: Final Report for U.S. Department Of Energy Grant EE-0002830

Mar 07, 2014
2.23 MB
Publicly accessible
The McGee Mountain geothermal area was selected to test early-stage shallow temperature survey techniques and drill two slim holes to test the resource. Geothermal Technical Partners, Inc. was able to complete only a small portion of the project before lack of funding prevented f...
Authors
Zehner, R. Geothermal Technical Partners, Inc.
geothermalnevadamcgee mountainshallow temperature surveygeoprobegeochemistrygeologytransmissionreportgravitysurveyfeasibilityarchaeological clearancegeothermometrycost-effectivethermal anomaliescost

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas, Part 2

Mar 01, 2019
3.53 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texasheat flowsmusouthern methodist universitymemodeep direct-usegeological variabilitytravis peakpermitreservoireastman chemicalcross-sectionsabine upliftheatflownreltxdduthermal conductivitypermittingregulatory agenciesland accesssurface watersurface heat flowgeologic variability evaluation

January 2014 Dixie Valley Binary Cycle Production Data Report

Feb 05, 2014
12.08 kB
Publicly accessible
DOE Report of the binary cycle production data from Dixie Valley for January, 2014. Includes summarized data, operations, outages, and curtailments in order to support the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from...
Authors
Brown, D. Terra-Gen Sierra Holdings, LLC
geothermaldixie valleybinaryproduction reportsumamrybinary cycleunused heatbinary power plantlow temperaturebirnebottomingwaste watersupercritical cycle

Soda Lake Well Lithology Data and Geologic Cross-Sections

Dec 31, 2013
864.72 MB
Publicly accessible
Comprehensive catalogue of drill-hole data in spreadsheet, shapefile, and Geosoft database formats. Includes XYZ locations of well heads, year drilled, type of well, operator, total depths, well path data (deviations), lithology logs, and temperature data. Plus, 13 cross-sections...
Authors
E., J. University of Nevada
geothermalsoda lake geothermal areawell lithology datadrill-hole databasegeologic cross-sectionsgravity modelinggeosoft datashapefilesspreadsheetsvector dataillustrator filesshape fileshapefilearcgisgisgeospatial datageospatialdrill-holewell locationsnevada

August 2014 Dixie Valley Report Binary Cycle Production Data Report

Sep 10, 2014
13.51 kB
Publicly accessible
Generation data from August associated with the binary unit at Dixie Valley. Includes summary of data, operations, outages, and curtailments in order to support the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a bin...
Authors
Brown, D. Terra-Gen Sierra Holdings, LLC
geothermaldixie valleybinary systembottoming cyclebinary power plantproduction datadoereportaugustproduction reportbinary cycleunused heatlow temperaturebrinebottomingwaste waternevada

University of Illinois Campus Deep Direct-Use Feasibility Study Bedrock Geology ArcGIS Layers

Mar 20, 2018
3.31 MB
Publicly accessible
Bedrock Geology of Champaign County, Illinois, map layers (shapefiles). Layers included: 1) Champaign County bedrock units. 2) Champaign County bedrock surface contours. Contour interval of 25 feet. 3) Colchester coal surface contours. Contour interval of 50 feet. 4) Kimmswick...
Authors
Nelson, W. University of Illinois
geothermalenergychampaign countymahomet domebedrockcolchester coalkimmswick limestonenew albany shaleddudeep direct-usearcgisgeospatial datashapefileshape filegeologyil

Hot Pot: Regional Geologic and Surface Feature Map

Jun 28, 2013
2.5 MB
Publicly accessible
This archive contains an ArcGIS map package file that includes a relief base with the northern Nevada Hot Pot project area, generalized geology, selected mines, and major topographic features. Also included is a metadata file containing map features and their description.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeologymap packagegisgeologic mapmetadatageospatial dataarcgisshaded relieftopographyenergymajor highwaysmine locationscitiesfault data

Utah FORGE: Composite Raw Gravity Data 2021

Jun 04, 2021
7.3 kB
Publicly accessible
This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in me...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeutah forge gravity 2021forge gravity 2021gravity dataraw gravity dataraw datadatautahforgegravitygeophysicsgeophysicalgravimeter

Brady Geothermal Field Well Lithologies

Jul 22, 2015
16 kB
Publicly accessible
This dataset provides well lithologies and corresponding descriptions exported from the 3D Leapfrog geologic model of the Brady Geothermal Field in Northwestern Nevada. Two .csv files are included. The file labeled Well Lithologies Descriptions provides the descriptions for each l...
Authors
Lopeman, J. University of Wisconsin
geothermalwelllithologiesdescriptionlithology3dgeologic modelgeologyleapfrogbradyshot springsbradygeothermal areawell datanevada

2013 YTD Dixie Valley Binary Cycle Production Data

Aug 07, 2013
448.4 kB
Publicly accessible
Sensor data proving the technical and economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant from the low-temperature brine at the Dixie Valley Geothermal Power Plant. Monthly data for Jan 2013 October 7 2013
Authors
Lee, V. Terra-Gen Sierra Holdings, LLC
geothermaldixie valleybinary power plantlow temperaturebrineunused heatbottomingsupercritical cyclewaste waterbinary cycleegsraw datadatageothermal power plantpower plantnevada

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

First Results Project Hotspot Drilling

Mar 15, 2013
7.43 MB
Publicly accessible
Project Hotspot drilled 3 slim hole exploratory wells in southern Idaho, each just under 2 km deep. These holes were designed to investigate thermal structure in three different settings within the Snake River Volcanic Province: (1) along the axial volcanic high of the central SRP...
Authors
Shervais, J. et al Utah State University
geothermalsnake river plainyellowstone hotspotproject hotspotidahoscientific drillingdrillingexploration

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

April 2014 Dixie Valley Binary Cycle Production Data

Apr 30, 2014
293.72 kB
Publicly accessible
Generation data associated with binary unit. Used to demonstrate the techno-economic feasibility of utilizing the available unused heat to generate additional electric power from a binary power plant. *Note This data is incomplete. See link "Monthly Production Data September 2014...
Authors
Lee, V. Terra-Gen Sierra Holdings, LLC
geothermalbinary power plantproduction databottoming cyclebinarydixie valleynevadalow temperaturebrineunused heatbottomingbinary cycleenergy

SE Great Basin Play Fairway Analysis Heat and Permeability CRS

Nov 15, 2015
805.9 kB
Publicly accessible
Within this submission are multiple .tif images with accompanying metadata of magnetotelluric conductor occurrence, fault critical stress composite risk segment (CRS), permeability CRS, Quaternary mafic extrusions, Quaternary fault density, and Quaternary rhyolite maps. Each of th...
Authors
Brandt, A. University of Utah
geothermalutahse great basinexplorationplay fairway analysispfacrscomposite risk segmentmtcritical stresspermeabilitybasaltfaultrhyolitequaternarymapmagnetotelluricconductoroccurencefluid flowlineamentsfaultsquaternary faultsfault densityprobabilityeasterngreat basineastern great basindatageospatial data

Exploration Case Studies on OpenEI

Sep 27, 2013
239.12 kB
Publicly accessible
The goal of this project was to create a template (and associated form) on OpenEI to solicit crowd-sourced information sharing about various geothermal resource areas around the world. Over the past two years, twelve case studies have been researched by NREL staff testing the usa...
Authors
Young, K. National Renewable Energy Laboratory
geothermalexplorationopeneigeothermal areacase studyexploration historywell field descriptionhydothermal systemreservoirheat sourcegeochemistrywell field datatectonic settingcontrol structurebrophy modelblind geothermal systemmemo

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin
<< Previous234567891011Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service