OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 573.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"temperature gradient"×

Geothermal Resource at the McGee Mountain Prospect, Humboldt County, Nevada

Jul 01, 2010
2.64 MB
Publicly accessible
This report describes the geothermal resource at McGee Mountain, including: 1. Local geology 2. Thermal features 3. Known boreholes and temperature gradients 4. Geophysical surveys 5. Fluid geochemistry and geothermometry 6. Estimate of the heat-in-place Description of the heat-i...
Authors
Zehner, R. Geothermal Technical Partners, Inc.
geothermalnevadamcgee mountaingeologygeochemistrymonte carloheat in place estimatereportthermal featuresborehole gradienttemperature gradientgeophysicsgeophysical surveyboreholebore holegeothermometryfluidheat-in-place

Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation

Jan 01, 2010
780.83 kB
Publicly accessible
Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation, Walsh, et al, Ormat
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermal alterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidar3d geologic modelpeer reviewfield workhyperspectralgravitymineral assemblages

2011 Glass Buttes Exploration and Drilling

Jan 01, 2011
1.27 MB
Publicly accessible
2011 Geothermal Technologies Program Peer Review Presentation summarizing relevance, proposed approach, and logistics of the Glass Buttes Exploration and Drilling.
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermalalterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidarhyperspectralgravitymineral assemblages3d geologic modelfield workexplorationdrilling

Conducting a 3D Converted Shear Wave Project to reduce exploration risk at Wister, CA: Geothermal Technologies Program 2011 Peer Review

Jun 01, 2011
1.35 MB
Publicly accessible
2011 Peer Review of the 'Conducting a 3D Converted Shear Wave' Project to reduce exploration risk at Wister, CA.
Authors
Matlick, S. Ormat Nevada Inc
geothermalwister caconverted shear wave3c 3d seismictemperature gradient holesgravitymagneticexplorationblind

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Washington Play Fairway Analysis Geothermal Heat and Permeability Potential Geodatabases

Dec 15, 2015
309.26 MB
Publicly accessible
This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeli...
Authors
Norman, D. et al Washington Division of Geology and Earth Resources
geothermalmount st. helens seismic zonewind river valleymount bakerpermeabilityheatfavorabilityuncertaintyrisksensitivityplay-fairwaywashingtoncascade rangeslip tendencydilation tendencysigma 3maximum coulomb shear stressdisplacementdisplacement gradientmaximum shear strain ratedilational strain ratefaultvolcanic ventintrusive rocktemeprature gradientgeothermometryhot springfumarolegeothermal favorabilitystrain rategisarcgisgeospatial datageodatabasegdbwashington statepfa

Snake River Plain Play Fairway Analysis: Mountain Home Geothermal Area Natural State Model

Jul 28, 2015
19.23 MB
Publicly accessible
The Mountain Home area is characterized by high heat flow and temperature gradient. Temperature data are available from 18 boreholes with depths equal to or greater than 200 m, 5 of which have depths ranging from ~1340 m to ~3390 m (MH-1, MH-2, Bostic1, Lawrence D No.1, and Anschu...
Authors
Garg, S. et al Utah State University
snake river mountain home modelinggeothermalenergysnake river plainmountain homenumerical modelmagnetotelluricgravityplay fairwaynatural statethermal modelingmagnetotelluricsplay fairway analysissrpmtgeophysicsgeophysicaltemperaurepre-productionstatestructureresource assessmentpfamodellingnatural

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk

Analyzed DTS Data, Guelph, ON Canada

Jul 01, 2015
4.73 MB
Publicly accessible
Analyzed DTS datasets from active heat injection experiments in Guelph, ON Canada is included. A .pdf file of images including borehole temperature distributions, temperature difference distributions, temperature profiles, and flow interpretations is included as the primary analyz...
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperatureguelphimagespressuregradientwelldrill-holecodeontariocamatlab

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Geothermal Play Fairway Analysis for Low-Temperature Resources in the Denver Basin

Sep 30, 2023
404.21 MB
Publicly accessible
This dataset is part of an effort to highlight the advantages of incorporating low-temperature (< 150 C) geothermal resource evaluation into the implementation of combined heat and power (CHP), and geothermal direct use (GDU) technologies (e.g., space heating and/or cooling). For...
Authors
Davalos-Elizondo, E. et al National Renewable Energy Laboratory
geothermalenergypfaplay fairway analysisdenver basinsedimentary basincoloradogeospatialfavorabilitythermalrisk dataexplorationgeologygeologic dataeconomic datawater co-productiongroundwater levelshot spring locationsgeochemistryfaultsearthquakeseconomic feasibilitypythonresource favoribility mapsgeoreportgeopfaworkflowlow-temperature

Deep Direct-Use Feasibility Study Numerical Modeling and Uncertainty Analysis using iTOUGH2 for West Virginia University

Dec 20, 2019
384.67 MB
Publicly accessible
To reduce the geothermal exploration risk, a feasibility study is performed for a deep direct-use system proposed at the West Virginia University (WVU) Morgantown campus. This study applies numerical simulations to investigate reservoir impedance and thermal production. Because of...
Authors
Garapati, N. et al West Virginia University
geothermalwvutuscaroraitough2lbnlreservoir flow modelpermeabilityfracturematrixuncertainty analysisnumerical modelingmonte carlofirst-order-second-moment uncertainty propagation analysisfeasibilityddudeep direct-usemorgantownreservoir impedancethermal productionresource potentialthermal breakthroughpermeability modelseconomic analysispapergeothermicsgeothermal exploration riskexploration riskmodelingeconomicdirect usewest virginia universitytuscarora sandstoneflow modeluncertaintyanalysissimulationflow

Conducting a 3D Converted Shear Wave Project to Reduce Exploration Risk at Wister, CA

May 18, 2010
2.61 MB
Publicly accessible
2010 Peer Review of the 'Conducting a 3D Converted Shear Wave' Project to reduce exploration risk at Wister, CA. The presentation includes a timeline, budget, barriers, and partners. The objective of the project is also explained in the presentation.
Authors
Matlick, S. Ormat Nevada Inc
geothermalwister caconverted shear wave3c 3d seismictemperature gradient holesgravitymagneticexplorationblindshear waverisk reduction

Maui Gravity and Soil Gas Surveys

Apr 01, 2010
1.37 MB
Publicly accessible
Contains a ground-based gravity survey of South Maui and a series of soil CO2 flux and temperature surveys encompassing Maui and the Big Island. The gravity survey was collected from approximately 284 km2 and consisted of 400 gravity stations with 400 m spacing. Locations were de...
Authors
Akerley, J. Ormat Nevada Inc
geothermalgravitymauigeophysicsbouger anomalysoil fluxgeochemistrysoil gastemperaturehawaiibig island

McGee Mountain Shallow (2m) Temperature Survey, Humboldt County, Nevada 2009

Jan 01, 2009
12.49 kB
Publicly accessible
This shapefile contains location and attribute data for a shallow (2 meter) temperature survey conducted by Geothermal Technical Partners, Inc. during late 2008 and early 2009. Temperatures at 2m depth were measured at 192 separate points as outlined by Coolbaugh et al., 2007. The...
Authors
Zehner, R. Geothermal Technical Partners, Inc.
geothermalshallow temperature surveymcgee mountainhumboldt countynevada2-meter surveyheat flowshapefiletemperatureshallow thermal anomalyanomaly detectiongeospatial data

McGee Mountain Geoprobe Study, Humboldt County, Nevada

Jun 19, 2010
14.67 MB
Publicly accessible
Geoprobes were developed by the environmental industry to collect water, gas and soil samples from contaminated sites at shallow depths (10-40 meters), with a minimum of environmental disturbance. A modified Geoprobe was used to collect bottom hole temperatures, and attempt to col...
Authors
Tullar, K. Geothermal Technical Partners, Inc.
geothermalgeoprobewater samplingtemperature gradienttemperatureshallow temperature surveymcgee mountainhumboldt countynevadareport

Utah FORGE: Neubrex DTS Fiber Optic Temperature Data from Well 16B(78)-32 August 2025 Circulation and Huff-and-Puff Tests

Mar 28, 2026
447.3 MB
Publicly accessible
This dataset contains processed Neubrex Distributed Temperature Sensing data acquired in well 16B(78)-32 at the Utah FORGE site during August 2025 field operations. The data were collected during cross-well circulation testing from well 16A to well 16B and subsequent huff-and-puff...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergytemperaturedtsthermalgradientfiber opticscoiled tubingutah forgeegsneubrexdistributed temperature sensingfiber optic sensingcailbrated temperaturehdf5prodml16b78-32circulation testhuff and puffprocessed data

Utah FORGE: Well 52-21 Logs and Data: Roosevelt Hot Spring Area

Mar 03, 2016
97.37 MB
Publicly accessible
This is a compilation of logs and data from Well 52-21 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsutah egsroosevelt hot springutah geothermal wellswell logsutah well logsutah geothermalgeothermal well logsroosevelt hot springswater analysiswater qualitygeochemistryflow samplewireline samplepressure surveytemperature surveysubsurfacehistorywell schematicsite mapwell locationscasing schematicwell completionbhtgradienthydrothermal alterationcompensated soniccompensated neutronformation densityporositylaterlogdual inductionelectromagneticelectro-magneticthickness toolfracture identificationmud logcaliperboreholedownholegeophysicssurveygeophysicalgeochemicalwell datautah52-21well logresourcecharacterizationmilford

Play Fairway Analysis CA-NV-OR: San Emidio Geophysical Data

Aug 05, 2015
12.56 MB
Publicly accessible
Various geophysical exploration data for San Emidio KGRA
Authors
M, C. University of California
geothermalgeophysicssan emidiogravityself potential resistivitygradiometrymagneticpsinsargeophysical surveyinvestigationassessmentsurveysiteresourcespinterferometrygradientremote sensingmagneticsinsarca-nv-orpfaplay fairway analysis

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Analysis of Geothermal Resources in Three Texas Counties

Oct 30, 2020
37.52 MB
Publicly accessible
This project updates the geothermal resources beneath our oil and gas fields, as part of the research for the Texas GEO project. This report "Analysis of Geothermal Resources in Three Texas Counties" (October 2020) improves on previous mapping of the Texas resources for the counti...
Authors
Richards, M. and Batir, J. Southern Methodist University Huffington Department of Earth Sciences
geothermalenergytexas geobottom hole temperatureradiogenic heat productionthermal conductivity10 kmjackson county txcrockett county txwebb county txoil and gas wellstexasjackson countycrockett countywebb countyoil and gaswell dataformation temperaturetemperaturestratigraphyformationlithologytemperature gradientheat flowradiogenicmapborehole

Fracture Sustainability Pressure, Temperature, Differential Pressure, and Aperture Closure Data

Sep 30, 2016
8.04 MB
Publicly accessible
In these data sets, the experiment time, actual date and time, room temperature, sample temperature, upstream and downstream pressures (measured independently), corrected differential pressure (measured independently and corrected for offset and room temperature) indication of ape...
Authors
Kneafsey, T. Lawrence Berkeley National Laboratory
geothermalexperimentalfracturemechanicsgeochemistrypressuretemperaturedifferential pressureaperturedesert peaktitaniumgranitepressure gradientfracture investigation

Utah FORGE: Well 58-32 Stimulation Conference Paper and Data

Apr 24, 2019
1.8 MB
Publicly accessible
The U.S. Department of Energy's (U.S. DOE) Frontier Observatory for Research in Geothermal Energy (FORGE) is a field laboratory that provides a unique opportunity to develop and test new technologies for characterizing, creating and sustaining Enhanced Geothermal Systems (EGS) in ...
Authors
Best, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeopen hole stimulationwell 58-32 stimulationwell 58-32utah geothermalgrgegsdisccrete fracture flowreservoir stimulationstimulationhydraulic fracturingphase 2cforgepressureflowbackratetemperaturehydraulicflowutahopen-holemilfordroosevelt hot springspre-processedupper perforationlower perforationmicroseismicitydasdistributed acoustic sensinggeophysics

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Utah FORGE: Temperature Contours at 200 m

Feb 01, 2016
19.09 kB
Publicly accessible
The individual shapefiles in this dataset delineate estimated temperature contours (20, 40, 60, and 80 deg C) at a depth of 200 m in the Milford, Utah FORGE area. Contours were derived from 86 geothermal, gradient, and other wells drilled in the area since the mid-1970s with dept...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmilfordforgeutahegstemperature200 mcontour20406080shapefileshape filearcgisgisgeospatial datautah forgeresourcecharacterizationroosevelt hot springscontoursprocessed datamineral mountainscove fortwell data
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service