OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 67.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Depth to Basment"×
Gravity×

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

USGS Geophysics, Heat Flow, and Slip and Dilation Tendency Data used in Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
Size unavailable
Publicly accessible
This package contains USGS data contributions to the DOE-funded Nevada Geothermal Machine Learning Project, with the objective of developing a machine learning approach to identifying new geothermal systems in the Great Basin. This package contains three major data products (geoph...
Authors
DeAngelo, J. et al Nevada Bureau of Mines and Geology
geothermalenergygeophisicsnevadaslipdilationheat flowgravitymagneticsfaultsgeotiffsmachine learningexplorationcharacterizationhydrothermalgreat basingeophysicspfa

Snake River Plain Play Fairway Analysis: Phase 1 Report

Jan 25, 2016
13.65 MB
Publicly accessible
This presents the results of Phase 1 of the Snake River Plain Play Fairway Analysis project, along with a proposed work for Phase 2. No new data were collected, but we list data sources for our compilation. The Snake River volcanic province (SRP) overlies a thermal anomaly that e...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainarcgisegsgisgeospatial datatemperaturestructureresource assessmentpfamodelingresourcecharacterizationmountain homesnake river mountain home modelingnumerical modelmagnetotelluricsmagnetotelluricgravitythermalsrpmtgeophysicsblindidaho

Conducting a 3D Converted Shear Wave Project to Reduce Exploration Risk at Wister, CA

May 18, 2010
2.61 MB
Publicly accessible
2010 Peer Review of the 'Conducting a 3D Converted Shear Wave' Project to reduce exploration risk at Wister, CA. The presentation includes a timeline, budget, barriers, and partners. The objective of the project is also explained in the presentation.
Authors
Matlick, S. Ormat Nevada Inc
geothermalwister caconverted shear wave3c 3d seismictemperature gradient holesgravitymagneticexplorationblindshear waverisk reduction

Conducting a 3D Converted Shear Wave Project to reduce exploration risk at Wister, CA: Geothermal Technologies Program 2011 Peer Review

Jun 01, 2011
1.35 MB
Publicly accessible
2011 Peer Review of the 'Conducting a 3D Converted Shear Wave' Project to reduce exploration risk at Wister, CA.
Authors
Matlick, S. Ormat Nevada Inc
geothermalwister caconverted shear wave3c 3d seismictemperature gradient holesgravitymagneticexplorationblind

Newberry EGS Literature References

Apr 22, 2016
69.94 kB
Publicly accessible
Research references to literature about the Newberry geothermal area, Oregon.
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengeophysicsgeologyhydrothermalseismicstructurep waveelectricmagnetotelluriclithologyliteraturefield guidegeologic historyvolcano hazardsframeworkpetrologyexploratory drillingslimholeexplorationflow testingdrillholestructuralactive sourceteleseismictomographyresource characterizationmagma chambercrustalvelocitygravityemelectricalcompressional wavecoremineralogy

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Colorado Potential Geothermal Pathways

Feb 01, 2012
68.99 kB
Publicly accessible
This layer contains the weakened basement rocks. Isostatic gravity was utilized to identify structural basin areas, characterized by gravity low values reflecting weakened basement rocks. Together interpreted regional fault zones and basin outlines define geothermal "exploration f...
Authors
E., R. Flint Geothermal, LLC
geothermalcoloradobasement weaknessgravityfaultsfluid flowbasement weaknessesarcgisshapefileshape filegeospatialgeospatial datadatageophysicsexplorationpfaplay fairwayanalysissuperheated fluid flowvolcanic activityremote sensingfault detectionanomaly detection

Hawthorne Nevada Deep Direct-Use Feasibility Study Geophysics GIS Data

Mar 29, 2018
1.48 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergydirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotgravitymagneticaeromagaeromagneticsground magneticsgravity cross sectiondduhawthorne

Snake River Plain Play Fairway Analysis: Mountain Home Geothermal Area Natural State Model

Jul 28, 2015
19.23 MB
Publicly accessible
The Mountain Home area is characterized by high heat flow and temperature gradient. Temperature data are available from 18 boreholes with depths equal to or greater than 200 m, 5 of which have depths ranging from ~1340 m to ~3390 m (MH-1, MH-2, Bostic1, Lawrence D No.1, and Anschu...
Authors
Garg, S. et al Utah State University
snake river mountain home modelinggeothermalenergysnake river plainmountain homenumerical modelmagnetotelluricgravityplay fairwaynatural statethermal modelingmagnetotelluricsplay fairway analysissrpmtgeophysicsgeophysicaltemperaurepre-productionstatestructureresource assessmentpfamodellingnatural

Washington Geothermal Play Fairway Analysis Data From Potential Field Studies

Dec 20, 2017
277.52 MB
Publicly accessible
A recent study which adapts play fairway analysis (PFA) methodology to assess geothermal potential was conducted at three locations (Mount Baker, Mount St. Helens seismic zone, and Wind River valley) along the Washington Cascade Range (Forson et al. 2017). Potential field (gravity...
Authors
Anderson, M. et al Washington Geological Survey
geothermalenergygravitymagneticspotential fieldsplay fairwaywashingtonland useprocess watertransmissionurban areaswatershapefilearcgisgeospatial datagissite assessmentsite characterizationgeophysicsgeophysicalsurveyexplorationinvestigationpfawashington state

Gravity Data for West-Central Colorado

Apr 06, 2012
164.99 MB
Publicly accessible
Modeled Bouger-Corrected Gravity data was extracted from the Pan American Center for Earth and Environmental Studies Gravity Database of the U.S. at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was open...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalgravitybougercoloradoshapefilepoint shapefileline shapefileshape filegisarcgisgeospatialcontourwestcentralwest-centraldatageospatial data

Validation of Innovative Exploration Technologies for Newberry Volcano: Raw Gravity Data

Oct 11, 2010
265.07 kB
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Raw data used to prepare the Gravity Report by Zonge 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalgravitynewberryvolcanocalderainoovative exploration technologiesraw datageophysicsietexplorationrawdatahydrothermalegs

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

Multiple Data Sets Converge on a Geologic Structural Model for Glass Buttes, Oregon Geothermal Prospect, Patrick Walsh, et al, 2010 American Geophysical Union Poster Session

Jan 01, 2010
16.53 MB
Publicly accessible
Multiple data sets converge on a geologic structural model for Glass Buttes, Oregon geothermal prospect, Patrick Walsh, Brigette Martini, Chet Lide, Darrick Boschmann, John DIlles, Andrew Meigs, 2010 Ormat Nevada, Zonge Geophysical, Oregon State University American Geophysical Uni...
Authors
Walsh, P. et al Ormat Nevada Inc
geothermalglass buttesoregonstructural modelgravitybougerdemmagnetotelluricaeromagneticcolumbia plateaulidarhyperspectralinversionlineament

Utah FORGE: Composite Raw Gravity Data 2021

Jun 04, 2021
7.3 kB
Publicly accessible
This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in me...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeutah forge gravity 2021forge gravity 2021gravity dataraw gravity dataraw datadatautahforgegravitygeophysicsgeophysicalgravimeter

Utah FORGE: 3D Gravity Data

Jun 24, 2019
11.24 MB
Publicly accessible
These resources describe the 3D geophysical inversion modeling of gravity data at the FORGE site near Milford, Utah. FORGE is the Frontier Observatory for Research in Geothermal Energy and the site in Utah has been selected by the U.S. Dept. of Energy for a 5-year R&D program to t...
Authors
Hardwick, C. and Witter, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge3d gravity datagravity datautah forge gravity datautah geothermalcomplete bouguerdensity modelgravityterrestrial gravity surveyobserved gravityforgegeophysics3d3d model3d gravitygravity anomalyegsmilfordinversionmodellinginverseroosevelt hot springsbougertop of granitedensitysurveysimple bougerfree airterrain correctiongeologiccorrectioncorrectedutahmodelmodeling

Utah FORGE: Phase 3 Magnetotelluric (MT) Data

Oct 01, 2020
91.86 MB
Publicly accessible
New high-quality tensor MT data at 122 sites, including the vertical magnetic field and utilizing ultra-remote referencing, have been acquired over the Utah FORGE project area. The results will be used to delineate the densities of faults and fractures in crystalline basement rock...
Authors
Wannamaker, P. and Maris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge mtmt datamagnetotelluric datautah forgeforgeutah geothermalgeophysical datafinite elementfeafemgeophysicsgravitymagneticsmagnetotelluricsseismicgeodesyegsroosevelt hot springsmilfordsite characterization

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin

Gravity Survey on the Glass Buttes Geothermal Exploration Project Lake County, Oregon

Oct 12, 2011
1.19 MB
Publicly accessible
This report covers data acquisition, instrumentation and processing of a gravity survey performed on the Glass Buttes Geothermal Exploration Project, located in Lake County, Oregon for ORMAT Technologies Inc. The survey was conducted during 21 June 2010 to 26 June 2010. The surve...
Authors
Akerley, J. Ormat Nevada Inc
geothermaloregonglass buttesgravitygeophysicsgravity surveygravity datalake countyhat buttepotato lakedatareportorgps datasafetyenvironmental issuesimpact

The Convergence of Heat, Groundwater, & Fracture Permeability: Innovative Play Fairway Modeling Applied to the Tularosa Basin Project Report

May 31, 2017
5.76 MB
Publicly accessible
This report details all of the work done in Phase 2 of a geothermal exploration project in Tularosa Basin, New Mexico. Data acquired as part of Phase 2 includes field geology (geological reconnaissance and mapping), gravity surveys, shallow temperature surveys, well water sampling...
Authors
Nash, G. et al Energy and Geoscience Institute at the University of Utah
geothermalenergytularosapermeabilityplay fairway analysisphase 2new mexicopfaexplorationfield geologyreconnaissancemappinggravityshallow temperature surveywell water samplinggroundwater samplingwater samplinggravity surveygeothermometryshallow temptemperature loggingtemperaturemtmagnetotelluricmt surveypriorityresource assessmentmodelgeophysics

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data
<< Previous123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service