OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 56 of 56.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"basin depth"×
Drilling and Completion×

Energy Return On Investment of Engineered Geothermal Systems Data

Jan 01, 2012
1.05 MB
Publicly accessible
The project provides an updated Energy Return on Investment (EROI) for Enhanced Geothermal Systems (EGS). Results incorporate Argonne National Laboratory's Life Cycle Assessment and base case assumptions consistent with other projects in the Analysis subprogram. EROI is a ratio o...
Authors
Mansure, C. Arthur Mansure
geothermalenergyinvestmentreturnpaybackengineeredenergy return on investmentengineered geothermal systemenhanced geothermal systemefficiencyegseroicasingcementdiameterdepthgeteminputswellsnettruckingfuelmaterialsbentonitepolymerseconomicsassessmenteconomic

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

Utah FORGE: Well 16A(78)-32 Logs

Mar 08, 2021
10.01 GB
Publicly accessible
This dataset contains all well logs from Utah FORGE well 16A(78)-32. This includes the mud log, Sanvean Technologies logs, and Schlumberger logs. Please see the file descriptions below for information about each log.
Authors
Gilmour, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32 drilling logsutah forgeforgewell 16a78-32 sanvean logswell 16a78-32 schlumberger logswell 16a78-32 mud logutah geothermalwell dataloggingmud logsanvean logsschlumberger logs16a78-32well logegssanveanschlumbergerlithologyfmiformation microimagerfullborewellborecorecharacterizationdrillgeologydrill ratemineralstemperaturerate of penetrationropdrill stem test

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Discrete Fracture Network (DFN) Data

Jun 24, 2020
10.65 GB
Publicly accessible
The FORGE team is making these fracture models available to researchers wanting a set of natural fractures in the FORGE reservoir for use in their own modeling work. They have been used to predict stimulation distances during hydraulic stimulation at the open toe section of well 1...
Authors
Finnila, A. and Podgorney, R. Golder Associates Inc.
geothermalenergyutah forgeforgeutah geothermalreservoirengineeringhydraulicfracturingegsdiscrete fracture networkdfnfracture modellingmilfordmodelingfracturehydroshearinflatedpore pressurestressfracmanstimulationdrillingpressuregoldersimulationreservoir planninghydraulic fracturing
<< Previous123
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service