OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 76 - 100 of 239.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"carbonate geothermal system"×
Stimulation and Microseismicity×

Triggered MEQ Events on LBNL Permanent Seismic Array, Brady's EGS, March 2016

Jun 01, 2016
83.98 kB
Publicly accessible
List of triggered events recorded on LBNL's permanent EGS seismic array at Brady's geothermal field. This submission also includes links to the NCEDC EGS Earthquake Catalog Search page and to the metadata for the seismic array installed at Brady's Geothermal Field.
Authors
Robertson, M. University of Wisconsin
geothermalporotomoegsseismic monitoringseismic networkseismicitymicroseismicityinduced seismicitymeqbradybradys geothermal fieldbradys hot springsearthquake catalogearthquakestimulationgeophysicsgeophysicalseismic

Utah FORGE: 2024 Annual Report on Activities and Advancements

Jan 27, 2025
19.87 MB
Publicly accessible
This 2024 annual report for Phase 3B Year 2 at Utah FORGE provides an in-depth account of activities and advancements made at the site. Key achievements include drilling and stimulating the production well 16B(78)-32, creating a geothermal reservoir, and achieving commercial-scale...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgephase 3byear 2yearly reportreportutah forge reportdrillingreservoir creationutah forge phase 3b report2024 annual reportegswell 16b78-32stimulationcirculationfiber optic monitoringdrilling technologiesseismic monitoringresearch and developmenttechnical reportannual report

Penn State Lab Testing Fluid-Rock Interaction in Geothermal Reservoirs

Jan 01, 2018
5.53 GB
Publicly accessible
This project focused on assessment and discovery of fluid-rock interaction in geothermal reservoirs. We accomplished work in four main areas: 1) fracture formation and the relationship between fluid flow and shear failure, 2) assessment of fracture geometry and fluid permeability ...
Authors
Madara, B. et al Pennsylvania State University
geothermalenergylab testingfracture formationshear failurefluid flowfracture geometryfluid permeabilityacoustic measurementsinjectionseismicitytriaxial experimentsdynamic stressingreservoir permeabilityfracture flowpermeability evolutionacoustic fracture characterizationfrictional stabilitydynamic triggeringinjection induced seismicityinduced seismicityshear slipshear flowberea sandstonewesterly graniteegsacoustic emissionslab earthquakes

Using Fully Coupled Hydro-Geomechanical Numerical Test Bed to Study Reservoir Stimulation with Low Hydraulic Pressure

Jan 31, 2012
6.63 MB
Publicly accessible
This paper documents our effort to use a fully coupled hydro-geomechanical numerical test bed to study using low hydraulic pressure to stimulate geothermal reservoirs with existing fracture network. In this low pressure stimulation strategy, fluid pressure is lower than the minimu...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalreservoir modelinghydraulic shearinghydraulic fracturingfracturereservoir stimulationlow pressurestimulation

Brady's Geothermal Field Nodal Seismometer Earthquake Data

Mar 21, 2016
95.92 MB
Publicly accessible
90-second records of data from 238 three-component nodal seismometer deployed at Bradys geothermal field. The time window catches an earthquake arrival. Earthquake data from USGS online catalog: Magnitude: 4.3 ml +/ 0.4 Location: 38.479 deg N 118.366 deg W +/ 0.7 km Depth: 9.9 km...
Authors
Feigl, K. University of Wisconsin
geothermalpassive seismicearthquakebrady geothermal fieldnevadaporotomoseismicmonitoringeqmicroseismicitymicroseismic3-componentnv

Thermal Drawdown Induced Flow Channeling in Fractured Geothermal Reservoirs: Rock Mechanics and Rock Engineering

Nov 15, 2015
16.88 MB
Publicly accessible
We investigate the flow-channeling phenomenon caused by thermal drawdown in fractured geothermal reservoirs. A discrete fracture network-based, fully coupled thermal "hydrological" mechanical simulator is used to study the interactions between fluid flow, temperature change, and t...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalthermal drawdownflow channelingthermomechanical couplingreservoir simulationstimulationegsenhanced geothermal reservoirsexplosive fracturing

Utah FORGE 4-2541: Final Report and Presentation on Optimization and Validation of a Plug and Perf Stimulation Treatment Design

Jul 15, 2025
219.13 MB
Publicly accessible
This dataset contains the final technical report and closeout presentation for Utah FORGE Project 4-2541, which focused on the optimization and validation of a multistage plug and perf stimulation treatment design for enhanced geothermal systems. The report documents drilling, com...
Authors
Norbeck, J. Fervo Energy
geothermalenergyplug and perfstimulationutah forgeegshorizontal drillingmonitoring wellfiber-optic monitoringdistributed acoustic sensingdasdistributed temperature sensingdtspressuretemperaturestimulation performanceflow allocationfracture geometryinjectivityinduced seismicitytechnical reporthydraulic stimulation

Utah FORGE 5-2565: Final Report on the Evolution of Permeability and Strength Recovery of Shear Fracture Under Hydrothermal Conditions

Aug 24, 2025
3.52 MB
Publicly accessible
This report discusses the results of research on the ability to create and/or reactivate and subsequently sustain fracture systems which are strongly influenced by complexly coupled mechanical (M) and chemical (C) processes in reservoirs forced from equilibrium by hydraulic stimul...
Authors
Jeppson, T. et al United States Geological Survey
geothermalenergyutah forgeegsenhanced geothermal systemsfluid-rock interactionsthmc processesfracture evolutionusgsfracturesgeothermal resorvoirsfracture reactivationthmcmechanicalchemicalhydraulic stimulationthermal drawdownfinal reporttechnical report

GEISER Project The Geysers Seismic Broadband Data 2012 2013

Oct 31, 2018
Size unavailable
Publicly accessible
This link points to the Northern California Earthquake Data Center (NCEDC) to access The Geysers seismic broadband data. The two available data sets consist of continuous waveform data recorded at The Geysers from July 2012 to July 2013 and a processed catalog with earthquake info...
Authors
Gritto, R. Array Information Technology
geothermalenergyseismic broadband dataseismicmicroseismiccontinuousinducedseismicitymicroseismicitymonitoringeventnetworkegsgeyserscacaliforniaarrivalearthquakegeisergeothermal engineering integrating mitigation of induced seismicity in reservoirsmitigationreservoirsstimulationresourcedevelopmenthydraulic

Utah FORGE 5-2419: Final Report and Presentation on Seismicity Permeability Relationships Probed via Nonlinear Acoustic Imaging

Sep 30, 2025
254.88 MB
Publicly accessible
This submission contains the final technical report and closeout presentation for Utah FORGE Project 5-2419, which investigates the coupled evolution of permeability and induced seismicity in enhanced geothermal systems using laboratory experiments, field observations, and nonline...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegspermeabilityinduced seismicitylaboratory experimentsfield observationsnonlinear acoustic imagingfault reactivationreservoir rockmicroearthquakestimulationphysics informed modelingmachine learningseismic momentstress statepermeability creationseismic hazardtechnical reportgeomechanicsgeophysicsmicroseismicity

Final Report: Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Nov 18, 2015
31.13 MB
Publicly accessible
This is a final report summarizing a two-year (2014-16) DOE funded Geothermal Play Fairway Analysis of the Low-Temperature resources of the Appalachian Basin of New York, Pennsylvania and West Virginia. Collaborators included Cornell University, Southern Methodist University, and ...
Authors
E. Jordan, T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacitygpfa-abgeothermal play fairway analysisthermal analysisresource assessmentheat flowthermal conductivitygeothermsheat utilizationsurface leveled cost of heatlcohslcohdemandgeophirescombined risk segment mapsrisk analysisinduced seismicityfaultspotential fieldswaveletsbht correctionslow temperature

Utah FORGE 5-2615: Final Report for the Experimental Determination and Modeling-Informed Analysis of Thermo-Poromechanical Response of Fractured Rock

Jun 30, 2025
6.17 MB
Publicly accessible
This is the final technical report documenting laboratory experiments and modeling conducted to characterize the thermo-poromechanical behavior of fractured crystalline rocks for application to Utah FORGE. The report includes measurements of poroelastic and thermo-poroelastic prop...
Authors
Ghassemi, A. The University of Oklahoma
geothermalenergyutah forgeegslaboratory experimentstechnical reportthermo-poromechanicalfracturingporoelasticthermo-poroelasticpermeability evolutionhydraulic fracturedfitmodeling resultsstressfracture mechanicsgeomechanicsblock-scalebiot effective stressclosure pressurethermal stresstransverse fracturesstimulation

Microearthquake Studies at the Salton Sea Geothermal Field

Oct 01, 2013
409.48 kB
Publicly accessible
The objective of this project is to detect and locate microearthquakes to aid in the characterization of reservoir fracture networks. Accurate identification and mapping of the large numbers of microearthquakes induced in EGS is one technique that provides diagnostic information w...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalseismicityearthquakesmicroearthquakesinduced seismicityfractureseismologysalton sea

Utah FORGE: Documentation on Discrete Fracture Network and Fracture Propagation Modelling

Feb 07, 2023
6.04 MB
Publicly accessible
This dataset includes reports and a slide presentation on discrete fracture network (DFN) generation and hydraulic fracture modeling at the Utah FORGE site. It details the characterization of natural fractures using well log and core data, as well as stochastic modeling techniques...
Authors
Sharma, M. and Cao, M. University of Texas
utah forgegeothermalfracture modellingdiscrete fracture modellingfracture propagation modellingutah forge fracture modellingdfnwell 16a78-32well 58-32fracture propagationegsenhanced geothermal systemsstimulationprocessed data

Utah FORGE 3-2417: DAS Microseismic Event and MT Catalog from the 16A/16B Circulation Test [Final, Relocated], 2023

May 19, 2025
1.34 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog from distributed acoustic sensing (DAS) acquisition conducted during the 16A-16B circulation tests that took place in July 2023. These results update the catalog presented in GDR 1613 (the preliminary catalog, lin...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalevent catalog16a16bcirculationcirculation testinversionseismic eventsevent detectionmtdistributed acoustic sensingprocessed datamicroseismic event catalogmeqfogmore

Development of a Neutron Diffraction Based Experimental Capability for Investigating Hydraulic Fractures for EGS-like Conditions

Feb 01, 2013
385.75 kB
Publicly accessible
Understanding the relationship between stress state, strain state and fracture initiation and propagation is critical to the improvement of fracture simulation capability if it is to be used as a tool for guiding hydraulic fracturing operations. The development of fracture predict...
Authors
Polsky, Y. et al Oak Ridge National Laboratory
geothermalneutron diffractionstress statestrain statefracture initiationfracture simulationfracture predictionhydraulic fracturing neutron strain measurementhydraulic fracturingegshigh temperaturehigh pressurefracture

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

Bradys Geothermal Field MEQ Relocations 3D Velocity Models

Jul 01, 2015
186.79 kB
Publicly accessible
Hypocenters of local microearthquakes and 3D P and S-velocity models computed by simultaneous inversion of arrival times recorded by the Brady seismic network Nov 2010-Mar 2015.
Authors
Foxall, W. University of Wisconsin
geothermalmicroearthquake locationssimultaneous inversion3d seimic velocity modelsd seismic velocity modelmicroeathquake locationsmetadatameqmicroearthquakemicroseismicityrelocationsvelocitymodel3dporotomobradyseismicitybrady hot springsbradys

Summary Fracturing of Coso Samples with StimuFrac

Sep 06, 2016
61.24 kB
Publicly accessible
Lab-scale stimulation was performed on Coso samples obtained from a single core (1623 feet TVD, reservoir Coso CGC 18-27) using StimuFrac and control fluid in the absence of stimuli-responsive polymer.
Authors
Fernandez, C. Pacific Northwest National Laboratory
geothermalstimuli-responsivecosoeffective pressurelab-scale stimulationegsstimufracfracking fluidhydraulic fracturingfracture mechanismsoverpressurestimulationegs reservoir

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Updated Overpressures and Permeability Values for PNNL's StimuFrac Fluid

Apr 06, 2016
471.63 kB
Publicly accessible
A corrigendum was submitted to the journal of Geothermics on our article "Environmentally friendly, rheoreversible, hydraulic-fracturing fluids for enhanced geothermal systems" Shao et al Geothermics 58 (2015) 22-31. In the original article some permeability values were underesti...
Authors
Shao, H. et al Pacific Northwest National Laboratory
geothermalstimuli-responsivefracking fluidcorrigendumgeothermicshydraulic fracturingstimulationegsreservoirfluid

EGS Collab Experiment 1: Tracer data tests

Apr 16, 2019
537.87 kB
Publicly accessible
This file contains the first set of tracer data for the EGS Collab testbed. The first set of tracer tests were conducted during October-November, 2018. We have included tracer data for C-dots, chloride, fluorescein, and rhodamine-B. The details about the tracer test can be found i...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergyegs collabsurftracer testsbreakthrough curvec-dotschloridefluoresceinrhodamine-btracer datahydraulicfracturingstimulationtracerexperimentalegssanford underground research facility

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Full Moment Tensors and Stress Inversion Catalogs

Sep 26, 2018
51.03 kB
Publicly accessible
This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the P...
Authors
Gritto, R. et al Array Information Technology
geothermalenergyseismic moment tensorstress orientationstress changesinversiongeysersegsenhanced geothermalazimuthplungemincroseismicityinjectionstimulationreservoirthe geysershigh temperature reservoirfull mtsolutionspassiveseismicseismicitymicroseismicitymonitoringarraymomenttensorcataloganalysisinducedstressprati 32demonstrationfracturespatio-temporalgenerationresourcedevelopmenthydraulicfaultingfaultearthquakegeophysicsgeophysical

Utah FORGE: Telluric Monitoring Experiment Transfer Functions

May 27, 2022
36.32 MB
Publicly accessible
The Utah Frontier Observatory for Research in Geothermal Energy (FORGE) attempted a stimulation at well 16A(78)-32 during April and May 2022. We recorded telluric and magnetotelluric (MT) data before, during, and after the well stimulation experiment using the FORGE Telluric Monit...
Authors
Mendoza, K. and Wannamaker, P. Energy and Geoscience Institute at the University of Utah
geothermalenergymagnetotelluricutah forgeforgeutahutah forge mtforge telluric monitoringftmgeophysicsmagneticswell datastimulationraw dataprocessed datawell 16a78-32transfer functionsmilford

Utah FORGE 3-2417: Simulations for Distributed Acoustic Sensing Strain Signatures as an Indicator of Fracture Connectivity

Jan 01, 2023
21.99 MB
Publicly accessible
This dataset encompasses simulations of strain signatures from both hydraulically connected and "near-miss" fractures in enhanced geothermal systems (EGS). The files and results are presented from the perspective of digital acoustic sensing's (DAS) potential to differentiate the t...
Authors
Ward-Baranyay, M. et al Rice University
geothermalenergyforgeutah forgeegsmilfordutahcomsoldfnmatlabsimulationnear-miss fracturedasdistributed acoustic sensingmodelingstrainfogmoregeophysicshydrogeomechanicssub-nanostraincodestimulation
<< Previous12345678Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service