OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 140.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"Metadata"×

Brady's Geothermal Field Metadata for DTS and DAS Surveys

Mar 26, 2016
10.46 MB
Publicly accessible
Metadata for DTS and DAS datasets for both borehole 56-1 and trenched cables.
Authors
Coleman, T. University of Wisconsin
geothermaldtsdastemperatureseismicnevadaboreholemetadatatrenched56-1distributed temperature sensingdistributed acoustic sensingbhporotomogeophysics

Guelph, ON Canada DTS Metadata

Dec 15, 2014
290.13 kB
Publicly accessible
Metadata for active distributed temperature survey (DTS) experiments at Guelph, Ontario Canada. This data that this metadata refers to was taken as part of the PoroTomo project. The metadata includes information about status, location, elevation, units, and other metadata.
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperaturemetadatadistributed temperature surveyporotomodistributed temperature sensingcaoncanadaontarioguelphlocationelevationwelldrillingdepth

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. shp and tif files are zipped with all applicable sideca...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Brady's Geothermal Field Reftek Seismometer Metadata

Mar 26, 2016
457.21 kB
Publicly accessible
Metadata for the Reftek seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatareftekseismometerseismicarraypassive seismicporotomobradygeophysicsmonitoringseismicity

Garner Valley DAS Metadata

Sep 10, 2013
21.69 kB
Publicly accessible
Metadata for the data collected at the NEES@UCSB Garner Valley Downhole Array field site on September 10-12, 2013 as part of the larger PoroTomo project.
Authors
Lancelle, C. University of Wisconsin
geothermaldistributed acoustic sensingfiber opticsporotomogarner valleydownhole arraymetadata

Brady Well Coordinates and Observation Sensor Depths

Mar 13, 2016
4.86 kB
Publicly accessible
Contains metadata associated with the wells used in the 2016 Spring Campaign led partially by UW Madison, LBNL, and LLNL scientists. Included with the well coordinates are the depths to the pressure sensors used in observation and pumping wells. Read me files are included for each...
Authors
Lim, D. University of Wisconsin
geothermalmetadatawell coordinatespressure sensor depthswell locationporotomobrady geothermalbradys geothermalfieldareawell datawell observation

DTS Raw Data Guelph, Ontario Canada

Jul 31, 2013
2.44 MB
Publicly accessible
Unprocessed active distributed temperature sensing (DTS) data from 3 boreholes in the Guelph, ON Canada region. Data from borehole 1 was collected during a fluid injection while data from boreholes 2 and 3 were collected under natural gradient conditions in a lined borehole. The...
Authors
Coleman, T. University of Wisconsin
geothermaldtstemperatureborehole dataguelphboreholedrill-holedownholelogontariocanadadistributed temperature sensingdistributed temperature surveywellwell dataraw datatemperature data

Brady's Geothermal Field Nodal Seismometers Metadata

Mar 28, 2016
279.97 MB
Publicly accessible
Metadata for the nodal seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing. Metadata includes location and timing for each instrument as well as file lists of data to be uploaded in a separate submission.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatanodalseismometersporotomobradys geothermal areaseismicarraymonitoringseismicitygeophysics

GDR Data Management and Best Practices for Submitters and Curators

Mar 31, 2021
10 MB
Publicly accessible
Resources for GDR data submitters and curators, including training videos, step-by-step guides on data submission, and detailed documentation of the GDR. The Data Management and Submission Best Practices document also contains API access and metadata schema information for develo...
Authors
Weers, J. et al National Laboratory of the Rockies
geothermalenergygdrdatafederationmetadatastandardssubmissiontrainingbest practicesguideapimanagementstorage

Brady's Geothermal Field DTS Raw Data

Mar 26, 2016
4.73 GB
Publicly accessible
The submitted data correspond to the complete raw temperature datasets captured by the distributed temperature sensing (DTS) horizontal and vertical arrays during the PoroTomo Experiment. Files in each submitted resource include: .xml (level 0): Data that includes Stokes, Anti-S...
Authors
Coleman, T. University of Wisconsin
geothermalwell datasurface datadtstemperaturenevadatrenched cablenear surface datastokesanti-stokesprobedistributed temperature sensingdistributed temperature surveynvporotomoraw data

Hot Pot: Regional Geologic and Surface Feature Map

Jun 28, 2013
2.5 MB
Publicly accessible
This archive contains an ArcGIS map package file that includes a relief base with the northern Nevada Hot Pot project area, generalized geology, selected mines, and major topographic features. Also included is a metadata file containing map features and their description.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeologymap packagegisgeologic mapmetadatageospatial dataarcgisshaded relieftopographyenergymajor highwaysmine locationscitiesfault data

Triggered MEQ Events on LBNL Permanent Seismic Array, Brady's EGS, March 2016

Jun 01, 2016
83.98 kB
Publicly accessible
List of triggered events recorded on LBNL's permanent EGS seismic array at Brady's geothermal field. This submission also includes links to the NCEDC EGS Earthquake Catalog Search page and to the metadata for the seismic array installed at Brady's Geothermal Field.
Authors
Robertson, M. University of Wisconsin
geothermalporotomoegsseismic monitoringseismic networkseismicitymicroseismicityinduced seismicitymeqbradybradys geothermal fieldbradys hot springsearthquake catalogearthquakestimulationgeophysicsgeophysicalseismic

WHOLESCALE: Seismic Survey Metadata from San Emidio Nevada 2021

Apr 06, 2021
25.39 MB
Publicly accessible
This is a collection of metadata from the 2021 seismic survey at the San Emidio geothermal field in Nevada. In April and May 2021, 37 tri-axial short period seismographs were deployed in a 1.8km diameter cluster centered on 40.367278 deg N, 119.409019 deg W. The first data record...
Authors
Lord, N. et al Department of Geoscience University of Wisconsin-Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadasmartsolodatacubedldsacsan emidiogeophysicssurvey designpythondata processingpumping

WHOLESCALE: Seismic Survey Data from San Emidio Nevada 2021

Apr 06, 2021
1.67 TB
Publicly accessible
This dataset includes raw and processed seismic data from the 2021 seismic survey at the San Emidio geothermal field in Nevada. In April and May 2021, 37 tri-axial short period seismographs were deployed in a 1.8km diameter cluster centered on 40.367278 N, 119.409019 W. The first...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsacraw dataprocessed datageophysicssiesmic datasmartsolodatacubeseismographdata lakesan emdidionevadapumpingtri-axialdld

Utah FORGE: Earth Model Native State Simulation Results

Jul 16, 2019
6.69 MB
Publicly accessible
Utah FORGE phase 2C Native State Simulation zip contains the data used for the boundary conditions and subsequent native state simulation results obtained using the simulation code FALCON. Data are from the nodes of the simulation domain, with used a uniform 50m spacing over a 250...
Authors
Podgorney, R. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutah geothermalnative state simulationfalconearth modelsimulationmilfordroosevelt hot springsegsanisotropic permeability and porositypermeabilityporositynative statedfnidaho national laboratoryinlmodelingmodellingreservoirparametersproperties

Brady's Geothermal Field Seismic Network Metadata

Dec 21, 2014
38.38 kB
Publicly accessible
Brady's geothermal field seismic network station locations and dates of operation.
Authors
Foxall, W. University of Wisconsin
geothermalegs microearthquake monitoringbrady egs seismic monitoring networkmetadataseismic networkseismic monitoringbradyegsporotomoseismicitymicroseismicitymeqinduced seismicitybradys geothermal fieldbradys hot springsearthquake

Brady's Geothermal Field Active Source Seismic Survey MetaData

Mar 28, 2016
2.03 MB
Publicly accessible
Sweep parameters, source locations and trigger timing for the four Phases of active source seismic data acquisition.
Authors
Robertson, M. University of Wisconsin
geothermalbrady geothermalactive sourceegsvibroseisseismicsource locationtrigger timegeophysicsgeophysicalporotomo

Hot Pot: Contoured Temperature Gradient Map

Jun 28, 2013
90.5 kB
Publicly accessible
Temperature gradient contours derived from Oski temperature gradient hole program and from earlier published information.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot pottemperature gradientmap packagemetadatagisgeospatial data

InSAR Maps of Deformation Covering Raft River, Idaho from 2007 to 2010

Mar 11, 2007
196.13 MB
Publicly accessible
This dataset contains maps of deformation covering Raft River, Idaho from 2007 to 2010 calculated from interferometric synthetic aperture radar data. This dataset is used in the study entitled "Inferring geothermal reservoir processes at the Raft River Geothermal Field, Idaho, US...
Authors
Reinisch, E. University of Wisconsin
geothermalenergyraft river geothermal fieldinsarenvisatsatelliteinterferometric synthetic aperture radaregsreservoir developmentreservoir modeling

Hawaii Play Fairway Analysis: USGS data for Geothermal Wells in Hawaii

Jan 01, 2015
2.96 kB
Publicly accessible
Aqueous chemistry and well metadata from the USGS for Geothermal Wells in Hawaii
Authors
Lautze, N. University of Hawaii
geothermalwellshawaiiusgsmetadatalcoationdepthwell idoahumolokaimauichemistrywater chemistryaqueous chemistrygeochemistrymgcltdstotal dissolved solidstemperaturewell coordinatesgeochemicalpfa

Hot Pot: Evidence of Quaternary Faulting

Jun 27, 2013
49.99 kB
Publicly accessible
Compilation of published data, field observations and photo interpretation relevant to Quaternary faulting at Hot Pot.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeologyquaternary faultingmetadatageospatial datagis

Hot Pot: Field Observations

Jun 28, 2013
61.59 kB
Publicly accessible
Map of field observations including depressions, springs, evidence of former springs, travertine terraces and vegetation patterns. Map also contains interpretation of possible spring alignments.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeologyfield observationsmetadatagismap packagegeospatial data

Hot Pot: Complete Bouguer Gravity Map

Jun 28, 2013
88.7 kB
Publicly accessible
Contoured Bouguer gravity survey with lease block outline in 2010 and location of hot springs.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeophysicsgravity surveymetadatabouger anomalygravity mapmap packagegisgeospatial data

Bradys Geothermal Field MEQ Relocations 3D Velocity Models

Jul 01, 2015
186.79 kB
Publicly accessible
Hypocenters of local microearthquakes and 3D P and S-velocity models computed by simultaneous inversion of arrival times recorded by the Brady seismic network Nov 2010-Mar 2015.
Authors
Foxall, W. University of Wisconsin
geothermalmicroearthquake locationssimultaneous inversion3d seimic velocity modelsd seismic velocity modelmicroeathquake locationsmetadatameqmicroearthquakemicroseismicityrelocationsvelocitymodel3dporotomobradyseismicitybrady hot springsbradys

Utah FORGE: DAS and Downhole Geophone Data from the August-September 2024 Circulation Test

May 01, 2026
Size unavailable
In progress
This dataset contains distributed acoustic sensing (DAS) and downhole geophone data collected during the August-September 2024 circulation period at the Utah FORGE site. The DAS data were acquired from well 16B(78)-32 as continuous H5 records during circulation operations. Embedde...
Authors
Dyer, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeegsdistributed acoustic sensingdasdownhole geophone3c geophonethree-component geophonecirculation testh5seg-2datstrain rate16b78-3256-3278b-32seismic datawell trajectoriesgeophysicsraw dataprocessed data
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service