Search GDR Data

Showing results 1 - 25 of 458.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"ArcGIS data"×
EGS×

Fallon FORGE: ArcGIS Site Location and Geologic Model Range Polygons

Mar 01, 2016
3.15 kB
Publicly accessible
A zip file containing two ArcGIS polygons of the FORGE site located in Fallon, Nevada. FallonFORGE3DGeologicModelRange is the 3D geologic model range and FallonFORGESite is the FORGE site location.
Authors
Blankenship, D. Sandia National Laboratories
geothermalfallonforgenevadaegsgisgeospatial dataarcgispolygonshapefileproject filegeologicmodelgeologysite locationsite boundarieslocationsite

Utah FORGE: Geology Map and GIS Data

Mar 15, 2018
528.07 MB
Publicly accessible
This archive contains a geology map of the general Roosevelt Hot Springs region, both in PDF and ArcGIS geodatabase formats, that was created as part of the Utah FORGE project.
Authors
Kirby, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergygeologygeology mapgisgeospatialgeospatial datafaultslithologygeologic featuresforgeutah forgegeodatabaseroosevelt hot springsutshapefileutahmapegsmilfordgeologic maparcgis

West Flank Coso FORGE Digital Elevation Model and Geology Shapefiles

Dec 21, 2015
794.28 MB
Publicly accessible
Geologic ArcGIS data of West Flank Coso, Ca FORGE site from a unpublished map by Rich Whitmarsh. The zip file includes a DEM, hillshade and four shapefiles of the general outlines of FORGE area.
Authors
Blankenship, D. Sandia National Laboratories
geothermalwest flankforgegeologic mapcaliforniawest flank cosoarcgis datageospatial datalidarhillshadesite mapegsshape fileboundaryboundaries3d modeldigital elevation modelgeologyshapefiledemcosoremote sensing

Utah FORGE: Area Terrain Slope Data

Dec 10, 2018
9.27 GB
Publicly accessible
This archive contains a terrain slope image, in units of degrees, of the Utah FORGE area near Roosevelt Hot springs. The data was derived from 0.5 m resolution LiDAR DEM data and is in a GeoTiff format. It was processed using ArcGIS.
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeslopeslope imageroosevelt hot springsterrain slopeslope degreesutah forgemilfordtopographylidardigital elevation modeldemgeotiffgeospatial dataarcgisgisutahterrainprocessed dataegsremote sensing

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

Utah FORGE: Heat Flow Contours and Well Data

Mar 09, 2016
29.85 kB
Publicly accessible
This submission contains a shapefile of heat flow contour lines around the FORGE site located in Milford, Utah. The model was interpolated from data points in the Milford_wells shapefile. This heat flow model was interpolated from 66 data points using the kriging method in Geostat...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalheatflowheatflowmilfordforgeegswellsutahdatashapefileshape filearcgisgeospatial datautah forgeheat flowcontourwell dataresourcecharacterizationroosevelt hot springsprocessed datageostatisticsbasementdepthmodeling

West Flank Coso FORGE: ArcGIS Data for Geologic Model

Mar 01, 2016
154.12 kB
Publicly accessible
Archive of ArcGIS data from the West Flank FORGE site located in Coso, California. Archive contains the following eight shapefiles: Polygon of the 3D geologic model (WestFlank3DGeologicModelExtent) Polylines of the traces 3D modeled faults (WestFlank3DModeledFaultTraces) Polyline...
Authors
Sandia National Laboratories
geothermalforgewest flankegscosoarcgis datacross-sectionseismic reflectionwell pathwell collarfault tracewell pathswell collarsgeospatial datamodelgeologygeologicfaulttracecalifornia

Utah FORGE: Faults, Fractures, and Lineaments in the Mineral Mountains

Mar 09, 2016
2.92 MB
Publicly accessible
This submission includes a shapefile of the Opal Mound Fault, and multiple datasets of lineaments mapped in the Mineral Mountains which overlook the Utah FORGE site, hyperlinked to rose diagrams in a polygon grid shapefile.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgelineamentsfracturesfaultsutahmilfordopal moundlineamentfracturejointegsmineral mountainsfaultopalmoundshapefileshape filearcgisgeospatial datautah forgegeologystructuralroosevelt hot springsrose diagram

Utah FORGE: Site Earthquake Animation

Mar 13, 2016
1.14 MB
Publicly accessible
This is a .kml earthquake animation covering the period of 1991 2011 for the Utah Milford FORGE site. It displays seismic events using different sized bubbles according to magnitude. It covers the general Utah FORGE area (large shaded rectangle) with the final site displayed as a ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsearthquakesgeospatialsimulationseismologyarcgisgoogle earthseismicityseismic monitoringbackgroundutahgeospatial dataearthquakeanimationtime lapseeventmagnitude

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Utah FORGE: MT Stations and Raw Data

Mar 09, 2016
98.3 kB
Publicly accessible
There are two zipped folders in this submission. One contains a shapefile with the position of MT stations around the Milford FORGE Site, while the other has the raw MT data.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmtmagnetotelluricgeophysicsmilfordutahforgeegsgeophysicstationsshapefileshape filearcgisgeospatial dataproject fileutah forgeraw dataroosevelt hot springsstation locations

Utah FORGE: Regional Well Locations

Feb 22, 2018
7.42 kB
Publicly accessible
This archive contains a GIS point feature shapefile that shows the locations of wells in the general region of the Utah FORGE project, near Roosevelt Hot Springs. This includes Utah FORGE deep well 58-32 and wells for which data has been uploaded to the Geothermal Data Repository....
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgewellsspatial datagis datashapefilewell locationsroosevelt hot springswell indexarcgisgeospatial datawelllocation58-32utahegsmilfordregionalwell location

Utah FORGE: Temperature Contours

Mar 09, 2016
128.69 kB
Publicly accessible
This submission contains several ArcGIS shapefiles, each with Temperature contour lines at different depths. Subsurface temperature were important for characterizing the geothermal system beneath the FORGE site in Milford, Utah.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalegsmilfordforgetemperaturecontourutahcontour linesutah forgegeospatial datashapefileresourcecharacterizationroosevelt hot springsprocessed data

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Utah FORGE: GPS Data Deformation Monitoring

Jun 24, 2019
349.04 MB
Publicly accessible
This data bundle contains raw GPS data files and resulting data using Trimble Business Center and NOAA OPUS to process the GPS data in spreadsheets with station coordinates and elevations. A map of station locations is included along with the final processing report which includes...
Authors
Erickson, B. and McKean, A. Energy and Geoscience Institute at the University of Utah
geothermalenergygps datautah forgedeformation monitoringutah geothermalgpsdeformationhorizontal velocitygeodesystructuralgeologynoaaopustbcutah geological surveygnssforgesystems analysisphase 2cmonitoringtrimblepstmpsdmmilfordroosevelt hot springsutahraw dataprocessingpre-processingreportegsremote sensingstation coordinatesprocessed data

Utah FORGE: X-Ray Diffraction Data

Feb 07, 2018
96.91 kB
Publicly accessible
This dataset contains X-ray diffraction (XRD) data taken from wells and outcrops as part of the DOE GTO supported Utah FORGE project located near Roosevelt Hot Springs. It contains an Excel spreadsheet with the XRD data, a text file with sample site names, types, and locations in ...
Authors
Nash, G. and Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyx-ray diffractionxrdutah forgeforgeutahroosevelt hot springsmineralogylithologyxrayutshapefilegeospatial dataarcgiscrystallographycrystalline mineralswell dataoutcropgeochemistryegsmilfordresourcecharacterization

Utah FORGE: Geologic, Topographic, and Other Related Maps and GIS Data from the Earth Model

Dec 07, 2018
964.98 MB
Publicly accessible
This submission contains a number of maps and shapefiles related to the Utah FORGE site. Examples include geologic maps (several variations) and GIS data for the Utah FORGE site outline. All data are georeferenced to UTM, zone 12N, NAD 83, NAVD 88.
Authors
Podgorney, R. et al Idaho National Laboratory
geothermalenergyforgeearth modelstudent competitiongeospatial dataroosevelt hot springsutahgisarcgisshapefilegeologygeologicmaptopographytopographicegsmilfordutah forgesiteoutlinefaultsquaternarystructural

Utah FORGE: Milford Site Location, Seismometer Locations, Basin Depth Models, and Potentiometric Contours

Mar 09, 2016
60.46 kB
Publicly accessible
This submission includes the geographic extent shapefile of the Milford FORGE site located in Utah, along with a shapefile of seismometer positions throughout the area, and models of basin depth and potentiometric contours.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalpotentiometriccontoursbasin depthstudy areamilfordegsforgeutahsiesmometerssiteextentgroundwatershapefileshape filearcgisgeospatial dataseismic monitoringutah forgesite locationseismometerseismologycontourgeologyseismicitygeophysicsmodeling

Favorable Geochemistry from Springs and Wells in Colorado

Feb 01, 2012
119.5 kB
Publicly accessible
This layer contains favorable geochemistry for high-temperature geothermal systems, as interpreted by Richard "Rick" Zehner. The data is compiled from the data obtained from the USGS. The original data set combines 15,622 samples collected in the State of Colorado from several sou...
Authors
E., R. Flint Geothermal, LLC
geothermalgeochemistrycoloradoarcgisgisshapefileshape filegeospatialgeospatial datahydrologywater samplesegsenhanced geothermal

Appendices for Geothermal Exploration Artificial Intelligence Report

Jan 08, 2021
2.76 GB
Publicly accessible
The Geothermal Exploration Artificial Intelligence looks to use machine learning to spot geothermal identifiers from land maps. This is done to remotely detect geothermal sites for the purpose of energy uses. Such uses include enhanced geothermal system (EGS) applications, especia...
Authors
Duzgun, H. et al Colorado School of Mines
geothermalenergyartificial intelligencehydrothermally altered mineralsmineral markerssvmgeodatabasewellfaultseismicaiborderbradydesert peaksalton sealand surface temperaturedeformationgeophysicalgeophysicssupport vector machinehyperspectralhyperspectral imagingcalifornianevadaegsblindblind systemdeep learningmachine learningexplorationgeospatial datashort wavelength infraredswirdatabaseanomaly detectionsite detectionradarhydrothermalmodelconceptual modelzoteroraw datapreproccessedprocessed dataenhanced geothermal systemengineered geothermal systemremote sensingarcgisgisinsarmorphologymorphologicalmorphological featurestirvnirvisible near infraredthermal infraredcodepython

Snake River Plain Play Fairway Analysis: Phase 1 Report

Jan 25, 2016
13.65 MB
Publicly accessible
This presents the results of Phase 1 of the Snake River Plain Play Fairway Analysis project, along with a proposed work for Phase 2. No new data were collected, but we list data sources for our compilation. The Snake River volcanic province (SRP) overlies a thermal anomaly that e...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainarcgisegsgisgeospatial datatemperaturestructureresource assessmentpfamodelingresourcecharacterizationmountain homesnake river mountain home modelingnumerical modelmagnetotelluricsmagnetotelluricgravitythermalsrpmtgeophysicsblindidaho

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Deep Direct-Use Feasibility Study Tuscarora Sandstone Geophysical Log Digitization

Dec 18, 2019
281.37 MB
Publicly accessible
This dataset contains well log files collected from wells penetrating the Tuscarora Sandstone, structural geologic map of West Virginia and salinity information based on brine geochemistry in West Virginia and Pennsylvania. A combination of proprietary and free software may be re...
Authors
Moore, J. West Virginia University
geothermalenergywvgeswvudduappalachian basintuscarora sandstonewell logsdeep direct-usegeochemistrygiswell datadigitizationstructural mapbrine geochemistrysalinity infomationfeasibilitypropertiesthicknessdepthdensitypermeabilityegsgeospatial data
12345Next >>