OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 83.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Frontier observartory for research in geothermal energy"×
Gravity×

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

West Flank Coso, CA Magnetic and Gravity Data

May 19, 2016
4.23 MB
Publicly accessible
Gravity and aeromagnetic data for West Flank FORGE site.
Authors
Katzenstein, A. et al Sandia National Laboratories
geothermalegsforgewest flankgravitymagneticaeromagneticgeophysicsgeophysical dataindian wells valleyeast-central californiacametamorphicstructuralaeromagcore complexcesium vapormagnetometercoso rangecoso

Utah FORGE: UGS Interactive Geoscience Map

Jan 01, 2021
Size unavailable
Publicly accessible
This is a link to the Utah Geological Survey's Utah FORGE Interactive Geoscience Map. The map layers include information on geology, geography, subsurface temperatures, seismicity, gravity and groundwater. Instructions for using the interactive map and a legend for the interactive...
Authors
Hill, J. Utah Geological Survey
geothermalenergyutah forgeinteractive mapgeology mapgravity maptemperature mapseismicity mapgroundwater mapugs mapsutah geological survey mapsutah forge mapsmapgeologyseismiclstgroundwaterhydrologyugsutahforgeinteractivegravityprocessed datageospatial datawater table depthgroundwater chemistrywellfaultwell temperaturetemperaturebedrockbedrock surfacebeddingfoliationcontactgeographycharcterizationegsmilfordroosevelt hot springsenhance geothermal systemengineered geothermal system

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

Utah FORGE: 3D Gravity Data

Jun 24, 2019
11.24 MB
Publicly accessible
These resources describe the 3D geophysical inversion modeling of gravity data at the FORGE site near Milford, Utah. FORGE is the Frontier Observatory for Research in Geothermal Energy and the site in Utah has been selected by the U.S. Dept. of Energy for a 5-year R&D program to t...
Authors
Hardwick, C. and Witter, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge3d gravity datagravity datautah forge gravity datautah geothermalcomplete bouguerdensity modelgravityterrestrial gravity surveyobserved gravityforgegeophysics3d3d model3d gravitygravity anomalyegsmilfordinversionmodellinginverseroosevelt hot springsbougertop of granitedensitysurveysimple bougerfree airterrain correctiongeologiccorrectioncorrectedutahmodelmodeling

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Fallon FORGE: Gravity and Magnetics Data

Mar 09, 2018
5.68 MB
Publicly accessible
This package contains principal facts for new gravity data collected September November 2017 in support of the Fallon FORGE project. Also included are rock core density and magnetic susceptibility data for key core intervals, used in modeling 2D and 3D gravity inversions. Indivi...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallongravitynevadadensitymagnetic susceptibilityvetted-nonvmagneticsbch-3foh-2sw51-20bunejug mountains3dinversiongeophysicsgravmagrock densityinverse modelgeospatial datadata

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Newberry EGS Literature References

Apr 22, 2016
69.94 kB
Publicly accessible
Research references to literature about the Newberry geothermal area, Oregon.
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengeophysicsgeologyhydrothermalseismicstructurep waveelectricmagnetotelluriclithologyliteraturefield guidegeologic historyvolcano hazardsframeworkpetrologyexploratory drillingslimholeexplorationflow testingdrillholestructuralactive sourceteleseismictomographyresource characterizationmagma chambercrustalvelocitygravityemelectricalcompressional wavecoremineralogy

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Hawaii Play Fairway Analysis: Gravity Model

Dec 15, 2015
4.49 MB
Publicly accessible
Gravity model for the state of Hawaii. Data is from the following source: Flinders, A.F., Ito, G., Garcia, M.O., Sinton, J.M., Kauahikaua, J.P., and Taylor, B., 2013, Intrusive dike complexes, cumulate cores, and the extrusive growth of Hawaiian volcanoes: Geophysical Research Let...
Authors
Lautze, N. University of Hawaii
geothermalgravityhawaiimodelgeophysicalgeophysicspfageospatial data

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Initial 3D Gravity Results at Newberry

Jul 31, 2015
Size unavailable
Publicly accessible
Initial 3D gravity results from Zonge Int'l recorded for the 4D EGS Monitoring project at Newberry, during stimulation of Well 55-29 by AltaRock Energy
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengravity3dgeophysicssurvey

Geothermal Exploration Raster Files for Utah Play Fairway Analysis

Jun 16, 2017
1.19 MB
Publicly accessible
This submission contains raster files associated with several datasets that include earthquake density, Na/K geothermometers, fault density, heat flow, and gravity. Integrated together using spatial modeler tools in ArcGIS, these files can be used for play fairway analysis in rega...
Authors
Wannamaker, P. Energy and Geoscience Institute at the University of Utah
geothermalenergyexplorationplay fairway analysisgravityheatearthquakefaultgeothermometerutahsevierpfawesternrasterheat flowfault systemsspatialgeospatialeasterngreat basineastern great basingeospatial datageophysicscharacterization

Eastern Great Basin Geothermal Play Fairway Analysis Report

Jun 01, 2017
111.23 MB
Publicly accessible
This is the final report for the second phase of geological, geophysical, and geochemical data collection and processing for the Eastern Great Basin Geothermal Play Fairway Analysis project.
Authors
Wannamaker, P. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutahplay fairway analysisplay fairwaygreat basineastern great basinfinal reportpfaresourceidentificationexplorationwesternutregionextensionvolcanismheatpermeabilityflowboreholemtmagnetotelluricsresistivityanomalygeochemistryfluidgasvolcaniceruptionfaultstresscriticallyseismicitygravitygeophysicsgeologictwin peaksrhyolite fieldseismicpassivenodalmappingheliumsurveyheprobability krigingcrater knolldrill holesitingcomposite riskphase 2geology

The Convergence of Heat, Groundwater, & Fracture Permeability: Innovative Play Fairway Modeling Applied to the Tularosa Basin Project Report

May 31, 2017
5.76 MB
Publicly accessible
This report details all of the work done in Phase 2 of a geothermal exploration project in Tularosa Basin, New Mexico. Data acquired as part of Phase 2 includes field geology (geological reconnaissance and mapping), gravity surveys, shallow temperature surveys, well water sampling...
Authors
Nash, G. et al Energy and Geoscience Institute at the University of Utah
geothermalenergytularosapermeabilityplay fairway analysisphase 2new mexicopfaexplorationfield geologyreconnaissancemappinggravityshallow temperature surveywell water samplinggroundwater samplingwater samplinggravity surveygeothermometryshallow temptemperature loggingtemperaturemtmagnetotelluricmt surveypriorityresource assessmentmodelgeophysics

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

DEEPEN: Newberry Volcano MT and Gravity Data 2022 and 2023 Acquisition and Processing

Jun 30, 2023
306.16 GB
Publicly accessible
As part of DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments), a 3D play fairway analysis (PFA) was conducted at Newberry Volcano in Central Oregon for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). For use in this PFA, ...
Authors
Schultz, A. et al Enthalpion Energy
geothermalenergydeepennewberrymtgravityresistivitydensitysingle inversionjoint inversioninversionraw dataprocessed datauncertaintyresolution matrixexplorationcharacterizationegshydrothermalsuperhot egssupercriticalmagmaticgeophysicsmt impedance3-d modeldaily reportsoregonpfaplay fairway analysis

Nevada Play Fairway Crescent Valley Geodatabase and Modeling Data

Aug 25, 2018
437.17 MB
Publicly accessible
This package contains data and metadata for 2-meter temperature probe survey, gravity, slip dilation, XRD analyses, play fairway modeling, and ArcGIS geodatabase resources. This project focused on defining geothermal play fairways and development of a detailed geothermal potentia...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergynevadaplay fairwaytemperaturegravityxrdgeophysicsgisgeospatial datageodatabasearcgisshapefileslipdilationcrescent valleynvwell datamappfaprobe surveymodelingnv great basin

Nevada Play Fairway Gabbs Valley Geodatabase and Modeling Data

Aug 25, 2018
338.07 MB
Publicly accessible
This package contains data and metadata for 2-meter temperature probe survey, gravity, slip dilation, play fairway modeling, and ArcGIS geodatabase resources. This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a lar...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergynevadaplay fairwaygravitytemperaturegeophysicsslipdilationpfaprobe surveymodelinggeodatabasegeospatial dataarcgisgisreportgabbs valleynvnv great basin
1234Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service