OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 457.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"GIS data"×
EGS×

Utah FORGE: AGRC GIS Database for the State of Utah

Mar 02, 2016
Size unavailable
Publicly accessible
This is a link to the Automated Geographic Reference Center (AGRC) that houses GIS data for the state of Utah. This includes geoscience, cadastre, elevation and terrain, digital aerial photography, roads, aquifer data, etc. Several GIS datasets used in the Utah FORGE project origi...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgegis datautah shapefilesutah roadsutah cadastreutah elevation datautah terrain datautah aquifersutah geoscience datautah cadastre datautah aquifer dataagrcutahgeospatial datageosciencecadastreelevationterrainaerial photographydigitalroadsaquifertopographybase mapimageryparcelsland ownershipgeologyearthquakeswaterremote sensing

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Utah FORGE: Geologic, Topographic, and Other Related Maps and GIS Data from the Earth Model

Dec 07, 2018
964.98 MB
Publicly accessible
This submission contains a number of maps and shapefiles related to the Utah FORGE site. Examples include geologic maps (several variations) and GIS data for the Utah FORGE site outline. All data are georeferenced to UTM, zone 12N, NAD 83, NAVD 88.
Authors
Podgorney, R. et al Idaho National Laboratory
geothermalenergyforgeearth modelstudent competitiongeospatial dataroosevelt hot springsutahgisarcgisshapefilegeologygeologicmaptopographytopographicegsmilfordutah forgesiteoutlinefaultsquaternarystructural

Utah FORGE: Regional Well Locations

Feb 22, 2018
7.42 kB
Publicly accessible
This archive contains a GIS point feature shapefile that shows the locations of wells in the general region of the Utah FORGE project, near Roosevelt Hot Springs. This includes Utah FORGE deep well 58-32 and wells for which data has been uploaded to the Geothermal Data Repository....
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgewellsspatial datagis datashapefilewell locationsroosevelt hot springswell indexarcgisgeospatial datawelllocation58-32utahegsmilfordregionalwell location

Utah FORGE: Geology Map and GIS Data

Mar 15, 2018
528.07 MB
Publicly accessible
This archive contains a geology map of the general Roosevelt Hot Springs region, both in PDF and ArcGIS geodatabase formats, that was created as part of the Utah FORGE project.
Authors
Kirby, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergygeologygeology mapgisgeospatialgeospatial datafaultslithologygeologic featuresforgeutah forgegeodatabaseroosevelt hot springsutshapefileutahmapegsmilfordgeologic maparcgis

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Utah FORGE: X-Ray Diffraction Data

Feb 07, 2018
96.91 kB
Publicly accessible
This dataset contains X-ray diffraction (XRD) data taken from wells and outcrops as part of the DOE GTO supported Utah FORGE project located near Roosevelt Hot Springs. It contains an Excel spreadsheet with the XRD data, a text file with sample site names, types, and locations in ...
Authors
Nash, G. and Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyx-ray diffractionxrdutah forgeforgeutahroosevelt hot springsmineralogylithologyxrayutshapefilegeospatial dataarcgiscrystallographycrystalline mineralswell dataoutcropgeochemistryegsmilfordresourcecharacterization

US Low-Temperature EGS Resource Potential Estimate

Jun 30, 2016
197.55 MB
Publicly accessible
Shapefile of shallow, low-temperature EGS resources for the United States, and accompanying paper (submitted to GRC 2016) describing the methodology and analysis. These data are part of a very rough estimate created for use in the U.S. Department of Energy Geothermal Technology O...
Authors
Mullane, M. et al National Renewable Energy Laboratory
geothermalegslow temperaturedirect useresource potentialshapefilegis datalow-tempvision studyestimategeovisionpaperthermal energyshallowgisgeospatial data

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

Fallon FORGE: ArcGIS Site Location and Geologic Model Range Polygons

Mar 01, 2016
3.15 kB
Publicly accessible
A zip file containing two ArcGIS polygons of the FORGE site located in Fallon, Nevada. FallonFORGE3DGeologicModelRange is the 3D geologic model range and FallonFORGESite is the FORGE site location.
Authors
Blankenship, D. Sandia National Laboratories
geothermalfallonforgenevadaegsgisgeospatial dataarcgispolygonshapefileproject filegeologicmodelgeologysite locationsite boundarieslocationsite

Utah FORGE: Geologic Maps

Mar 02, 2016
Size unavailable
Publicly accessible
This is a link to Utah geology maps in both pdf and GIS formats. This includes the geology of the Utah FORGE area. This site is maintained by the Utah Geological Survey.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsgeology mapsutah geology mapsgeological mapsutah geological mapsutah forge geologymilfordutah geological surveygeologyutahgeospatial datacharacterizationgeologicmaproosevelt hot springsugs

Utah FORGE: Updated Phase 2C Well Location Coordinates

Dec 07, 2020
16.48 kB
Publicly accessible
Utah FORGE has been established to develop, test, and improve the technologies and techniques required to develop EGS-type geothermal resources. Drilling of the first of two deep deviated wells, 16A(78)-32, will begin in the second half of 2020. This well will serve as the injecti...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeforgewell 56-32 locationwell 68-32 locationwell 78-32 locationutah forge phase 2gpsegsroosevelt hot springsmilfordgeospatial datagisshapefileutah geological surveywell dataphase 2cwell locationswell location

Deep Direct-Use Feasibility Study Tuscarora Sandstone Geophysical Log Digitization

Dec 18, 2019
281.37 MB
Publicly accessible
This dataset contains well log files collected from wells penetrating the Tuscarora Sandstone, structural geologic map of West Virginia and salinity information based on brine geochemistry in West Virginia and Pennsylvania. A combination of proprietary and free software may be re...
Authors
Moore, J. West Virginia University
geothermalenergywvgeswvudduappalachian basintuscarora sandstonewell logsdeep direct-usegeochemistrygiswell datadigitizationstructural mapbrine geochemistrysalinity infomationfeasibilitypropertiesthicknessdepthdensitypermeabilityegsgeospatial data

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data

Utah FORGE: Area Terrain Slope Data

Dec 10, 2018
9.27 GB
Publicly accessible
This archive contains a terrain slope image, in units of degrees, of the Utah FORGE area near Roosevelt Hot springs. The data was derived from 0.5 m resolution LiDAR DEM data and is in a GeoTiff format. It was processed using ArcGIS.
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeslopeslope imageroosevelt hot springsterrain slopeslope degreesutah forgemilfordtopographylidardigital elevation modeldemgeotiffgeospatial dataarcgisgisutahterrainprocessed dataegsremote sensing

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Fallon FORGE: Geodetic Data

Feb 01, 2018
335.78 MB
Publicly accessible
Fallon FORGE InSAR and geodetic GPS deformation data. InSAR shapefiles are packaged together as .MPK (ArcMap map package, compatible with other GIS platforms), and as .CSV comma-delimited plaintext. GPS data and additional metadata are linked to the Nevada Geodetic Laboratory data...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyfallonforgeegsinsargeodeticsgpsphase 2bnevadavetted-nonvinterferometricsynthetic aperture radargeodesyremote sensingdeformationgeospatial data

Utah FORGE: Area 0.5 m LiDAR Data

Oct 01, 2016
Size unavailable
Publicly accessible
During the Fall of 2016 AGRC and the Utah Geological Survey acquired ~205 square miles of 8 points per meter Quality Level 1 LiDAR of The Frontier Observatory for Research in Geothermal Energy (FORGE) area around Milford, Utah in Beaver and Millard Counties in western Utah. The 0....
Authors
Allis, R. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgedemdsmdigital elevation modeldigital surface modelegsenhanced geothermal systemsfrontier observatory for research in geothermal energyroosevelt hot springsutlidargeospatial datagisremote sensingutahdatamilford

Favorable Geochemistry from Springs and Wells in Colorado

Feb 01, 2012
119.5 kB
Publicly accessible
This layer contains favorable geochemistry for high-temperature geothermal systems, as interpreted by Richard "Rick" Zehner. The data is compiled from the data obtained from the USGS. The original data set combines 15,622 samples collected in the State of Colorado from several sou...
Authors
E., R. Flint Geothermal, LLC
geothermalgeochemistrycoloradoarcgisgisshapefileshape filegeospatialgeospatial datahydrologywater samplesegsenhanced geothermal

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
3.56 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingnevadamethodologyconceptual report

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
81.69 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingexplorationconceptual modelbaseline modelmodelbaselineappendicessupporting dataseismic datawell datageologic maps

Appendices for Geothermal Exploration Artificial Intelligence Report

Jan 08, 2021
2.76 GB
Publicly accessible
The Geothermal Exploration Artificial Intelligence looks to use machine learning to spot geothermal identifiers from land maps. This is done to remotely detect geothermal sites for the purpose of energy uses. Such uses include enhanced geothermal system (EGS) applications, especia...
Authors
Duzgun, H. et al Colorado School of Mines
geothermalenergyartificial intelligencehydrothermally altered mineralsmineral markerssvmgeodatabasewellfaultseismicaiborderbradydesert peaksalton sealand surface temperaturedeformationgeophysicalgeophysicssupport vector machinehyperspectralhyperspectral imagingcalifornianevadaegsblindblind systemdeep learningmachine learningexplorationgeospatial datashort wavelength infraredswirdatabaseanomaly detectionsite detectionradarhydrothermalmodelconceptual modelzoteroraw datapreproccessedprocessed dataenhanced geothermal systemengineered geothermal systemremote sensingarcgisgisinsarmorphologymorphologicalmorphological featurestirvnirvisible near infraredthermal infraredcodepython

Low-Temperature Hydrothermal Resource Potential Estimate

Jun 30, 2016
2.79 MB
Publicly accessible
Compilation of data (spreadsheet and shapefiles) for several low-temperature resource types, including isolated springs and wells, delineated area convection systems, sedimentary basins and coastal plains sedimentary systems. For each system, we include estimates of the accessible...
Authors
Mullane, M. et al National Renewable Energy Laboratory
geothermalhydrothermallow-temperaturedirect usespringswellsdelineated areasedimentary basinaccessible resource basemean extractable resourcebeneficial heatusgsresource potentialcoastal plainslow temperatureegsdepthshallow temperauteconvectionconductioncoastal plainisolatednrelsmubottom-hole-temperaturetemperature datadepth dataisolated systemshapefilegis data
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service