OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 73.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"data gap"×
Gravity×

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Publicly accessible
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Play Fairway Analysis CA-NV-OR: San Emidio Geophysical Data

Aug 05, 2015
12.56 MB
Publicly accessible
Various geophysical exploration data for San Emidio KGRA
Authors
M, C. University of California
geothermalgeophysicssan emidiogravityself potential resistivitygradiometrymagneticpsinsargeophysical surveyinvestigationassessmentsurveysiteresourcespinterferometrygradientremote sensingmagneticsinsarca-nv-orpfaplay fairway analysis

Utah FORGE: Composite Raw Gravity Data 2021

Jun 04, 2021
7.3 kB
Publicly accessible
This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in me...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeutah forge gravity 2021forge gravity 2021gravity dataraw gravity dataraw datadatautahforgegravitygeophysicsgeophysicalgravimeter

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

May 15, 2013
166.64 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The Project chose the Dixie Valley Geothermal System in Nevada as a field laboratory site for methodlogy calibration...
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappinggiscompressiondilatationmagnetotelluricsgravityseismicwellsfaultstemperaturegeospatial data

Validation of Innovative Exploration Technologies for Newberry Volcano: Raw Gravity Data

Oct 11, 2010
265.07 kB
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Raw data used to prepare the Gravity Report by Zonge 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalgravitynewberryvolcanocalderainoovative exploration technologiesraw datageophysicsietexplorationrawdatahydrothermalegs

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Gravity Survey on the Glass Buttes Geothermal Exploration Project Lake County, Oregon

Oct 12, 2011
1.19 MB
Publicly accessible
This report covers data acquisition, instrumentation and processing of a gravity survey performed on the Glass Buttes Geothermal Exploration Project, located in Lake County, Oregon for ORMAT Technologies Inc. The survey was conducted during 21 June 2010 to 26 June 2010. The surve...
Authors
Akerley, J. Ormat Nevada Inc
geothermaloregonglass buttesgravitygeophysicsgravity surveygravity datalake countyhat buttepotato lakedatareportorgps datasafetyenvironmental issuesimpact

Utah FORGE: Raw Microgravity Composite Data Updated 10/2021

Oct 01, 2021
7.98 kB
Publicly accessible
This is a microgravity dataset from the Utah FORGE site near Milford, Utah. This composite dataset was updated in October, 2021 and contains data from December 17th, 2018 through September 24th, 2021. The data includes the GPS location of the measurement, date of the measurement, ...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergygravity datamicrogravity datautah forgeutah forge microgravityutah forge gravityutah geothermalmigrogravitygravitydatageophysicsutahraw datagpsgravity station

Gravity Data for West-Central Colorado

Apr 06, 2012
164.99 MB
Publicly accessible
Modeled Bouger-Corrected Gravity data was extracted from the Pan American Center for Earth and Environmental Studies Gravity Database of the U.S. at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was open...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalgravitybougercoloradoshapefilepoint shapefileline shapefileshape filegisarcgisgeospatialcontourwestcentralwest-centraldatageospatial data

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

USGS Geophysics, Heat Flow, and Slip and Dilation Tendency Data used in Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
Size unavailable
Publicly accessible
This package contains USGS data contributions to the DOE-funded Nevada Geothermal Machine Learning Project, with the objective of developing a machine learning approach to identifying new geothermal systems in the Great Basin. This package contains three major data products (geoph...
Authors
DeAngelo, J. et al Nevada Bureau of Mines and Geology
geothermalenergygeophisicsnevadaslipdilationheat flowgravitymagneticsfaultsgeotiffsmachine learningexplorationcharacterizationhydrothermalgreat basingeophysicspfa

DEEPEN: Newberry Volcano MT and Gravity Data 2022 and 2023 Acquisition and Processing

Jun 30, 2023
306.16 GB
Publicly accessible
As part of DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments), a 3D play fairway analysis (PFA) was conducted at Newberry Volcano in Central Oregon for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). For use in this PFA, ...
Authors
Schultz, A. et al Enthalpion Energy
geothermalenergydeepennewberrymtgravityresistivitydensitysingle inversionjoint inversioninversionraw dataprocessed datauncertaintyresolution matrixexplorationcharacterizationegshydrothermalsuperhot egssupercriticalmagmaticgeophysicsmt impedance3-d modeldaily reportsoregonpfaplay fairway analysis

Utah FORGE: 3D Gravity Data

Jun 24, 2019
11.24 MB
Publicly accessible
These resources describe the 3D geophysical inversion modeling of gravity data at the FORGE site near Milford, Utah. FORGE is the Frontier Observatory for Research in Geothermal Energy and the site in Utah has been selected by the U.S. Dept. of Energy for a 5-year R&D program to t...
Authors
Hardwick, C. and Witter, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge3d gravity datagravity datautah forge gravity datautah geothermalcomplete bouguerdensity modelgravityterrestrial gravity surveyobserved gravityforgegeophysics3d3d model3d gravitygravity anomalyegsmilfordinversionmodellinginverseroosevelt hot springsbougertop of granitedensitysurveysimple bougerfree airterrain correctiongeologiccorrectioncorrectedutahmodelmodeling

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Gravity, Granite Springs Valley, Nevada Play Fairway Analysis

Sep 14, 2017
979.85 kB
Publicly accessible
All raw data for new data acquired, key grids such as CBA and horizontal derivative, acquisition report, and depth models. This gravity data is associated with the Nevada Play Fairway project.
Authors
Faulds, J. Nevada Bureau of Mines and Geology
gravitygranite springs valleygeophysicspfanevadanvmodelingacquisitiongridscbahorizontal derivativedepthmodelrawdatainvertedprofilesectioncorrectedfree airtidetidalreportdensity contrastgsvnv great basin

Validation of Innovative Exploration Technologies for Newberry Volcano: Gravity Report

Jan 06, 2012
4.75 MB
Publicly accessible
Report detailing data acquisition, quality, processing, and presentation for the gravity survey conducted on the Newberry Volcano. (Validation of Innovative Exploration Technologies for Newberry Volcano: Gravity Report of Newberry prepared by Zonge GeoSciences 2012)
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
geothermalgravitynewberryoregonvolcanocalderaexplorationinnovative exploration technologiesdeschutes countydata acquisitiongeophysicssurveyietreporthydrothermalegs

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous
123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service