OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 28.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"improved toughness"×
EGS×

Utah FORGE: Temperature-Dependent Mode-I Fracture Toughness of Granite from SCB Tests Dataset and Methods Report

Feb 23, 2026
617.16 kB
Publicly accessible
This submission includes a methods report and an accompanying Excel dataset documenting temperature-dependent Mode-I fracture toughness (KIC) measurements for Utah FORGE granite obtained using semi-circular bending (SCB) tests in accordance with the ISRM Suggested Method. Testing ...
Authors
Dvory, N. and McLennan, J. University Of Utah
geothermalenergyfracturefracture toughnessforgeutah forgefracture propagationscb/nscbtemperaturelefmfpzegsmodel-ikicsemi-circular bendingscbnscbgranitehigh-temperature testingwell 58-32laboratory testingraw datatechnical reportgeomechanics

Utah FORGE 2-2446: Characterizing Stress Roughness Through Simulation of Hydraulic Fracture Growth

Jan 30, 2025
2.55 MB
Publicly accessible
This dataset covers work that investigated the apparent toughness anisotropy at Utah FORGE by comparing microseismic data with stress profiles from field measurements. The study analyzes the hydraulic fracture growth of Stage 3 at Well 16A(78)-32 using MEQ data, calibrating a nume...
Authors
Cusini, M. and Fei, F. Lawrence Livermore National Laboratory
geothermalenergyutah forgestress roughnesshydraulic fracturingmeqegsstress profilefield measurementshydraulic fracture growth16a78-32stage 3geostechnical reportprocessed datageophysics2-2446toughness anisotropyrock mechanics

Improved Microseismicity Detection During Newberry EGS Stimulations

Oct 01, 2013
23.03 kB
Publicly accessible
Effective enhanced geothermal systems (EGS) require optimal fracture networks for efficient heat transfer between hot rock and fluid. Microseismic mapping is a key tool used to infer the subsurface fracture geometry. Traditional earthquake detection and location techniques are oft...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsseismicitymicroseismicitystimulationfracturereservoirearthquakesmonitoringmicroseismicseismicnewberry

Improved Microseismicity Detection During Newberry EGS Stimulations

Nov 01, 2013
214.5 kB
Publicly accessible
Effective enhanced geothermal systems (EGS) require optimal fracture networks for efficient heat transfer between hot rock and fluid. Microseismic mapping is a key tool used to infer the subsurface fracture geometry. Traditional earthquake detection and location techniques are oft...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalegsseismicitymicroseismicitystimulationfracturereservoirngds content modelusgin content modelinduced seismicitynewberrymicroearthquakemonitoringmeasurementdetectionhydrualic

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Utah FORGE 2-2446: Report on Laboratory Block Experiments with Six Different Combinations of Stresses and Rock Fabrics

Jan 30, 2025
15.21 MB
Publicly accessible
This report documents a series of block-scale hydraulic fracturing experiments, simulating Utah FORGE conditions to investigate how different combinations of in situ stress regimes, well orientations, and thermal stress conditions influence fracture initiation and propagation. The...
Authors
Bunger, A. and Lu, Y. Lawrence Livermore National Laboratory
geothermalenergyutah forgehydraulic fracturingtriaxial loadingegsblock-scalein situ stressthermal stimulationbreakdown pressurefracture propagationrock mechanicsfracture mappinglaboratory experimentsreservoir stimulationtechnical report

Mapping Fracture Network Creation with Microseismicity During EGS Demonstrations

Apr 18, 2014
9.07 MB
Publicly accessible
This a report for the project "Mapping Fracture Network Creation with Microseismicity During EGS Demonstrations". Effective enhanced geothermal systems (EGS) require optimal fracture networks for efficient heat transfer between hot rock and fluid. Microseismic mapping is a key too...
Authors
Templeton, D. et al Lawrence Livermore National Laboratory
geothermalmicroseismicegsfracture creationmappingalgorithmmicroseismicityfracturingfracturenewberry

Utah FORGE 3-2417: Fiber-Optic Geophysical Monitoring of Reservoir Evolution 2024 Annual Workshop Presentation

Aug 13, 2024
160.55 MB
Publicly accessible
This is a presentation on the Fiber-Optic Geophysical Monitoring of Reservoir Evolution by Rice University, presented by Jonathan Ajo-Franklin. This video slide presentation discusses the development of an end-to-end fiber-optic sensing approach for EGS to track the (1) initial zo...
Authors
Ajo-Franklin, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgerice universityfracture creationegsconnected mechanically compliant fracturesflowing fracturesthmdasdas microseismicpresentationvideo

Utah FORGE: Source Imaging DAS-Based Seismic Event Catalog April 2024 Stimulation

Aug 26, 2025
140.41 kB
Publicly accessible
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a DAS-specific source imaging workflow that avoids conventional phase picking. Instead, STA/LTA-transformed DAS and downhole...
Authors
Dvory, N. et al The University Of Utah
geothermalenergyforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationapril 2024 stimulation

EPRI Report: Enhancing Geothermal Representation in EPRI's US-REGEN Model

Dec 13, 2024
1.86 MB
Publicly accessible
This report examines improvements to the representation of geothermal resources and technologies, including hydrothermal, near-field, and deep enhanced geothermal systems (EGS), in EPRI's US-REGEN capacity expansion model. Using updated datasets from the National Renewable Energy ...
Authors
Molar-Cruz, A. and Johnson, N. National Renewable Energy Laboratory
geothermalenergycapacity expansion modelegshydrothermalus-regenenergy systems modelingcarbon capture and storageccstemperature-based classificationgeothermal cost assumptionsenergy planningrenewable energytechnology assessmentresource disaggregationpower generation modelingreedseprinreltechnical report

Utah FORGE 5-2565: Hydrothermal Evolution of Fracture Properties 2023 Annual Workshop Presentation

Sep 08, 2023
99.84 MB
Publicly accessible
This is a presentation on the Evolution of Permeability and Strength Recovery of Shear Fractures Under Hydrothermal Conditions project by the U.S. Geological Survey, presented by Dr. David Lockner. The project's objective was to determine how thermal, hydraulic, mechanical, and ch...
Authors
Lockner, D. et al United States Geological Survey
geothermalenergyannual workshop2023utah forgeegsfracture propertiesthmcpermeabilityfracture strengthmicromechanicalempiricalfracture modelsgeophysicsnumerical modelthermal couplingreservoir longevityfracture evolutionhydrothermalgeomechanicalgeochemicalpresentation

Utah FORGE 6-3629: Application of Machine Learning, Geomechanics, and Seismology for Real-Time Decision Making Tools During Stimulation 2024 Annual Workshop Presentation

Sep 15, 2024
41.44 MB
Publicly accessible
This is a presentation on the Cutting Edge Application of Machine Learning, Geomechanics, and Seismology for Real-Time Decision Making Tools During Stimulation by the University of Utah, presented by No'am Zach Dvory. This video slide presentation, by the University of Utah, disc...
Authors
Dvory, N. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsvideopresentationdecision support

Simulating Complex Fracture Systems in Geothermal Reservoirs Using an Explicitly Coupled Hydro-Geomechanical Model

Jan 01, 2011
6.5 MB
Publicly accessible
Low permeability geothermal reservoirs can be stimulated by hydraulic fracturing to create Enhanced (or Engineered) Geothermal Systems (EGS) with higher permeability and improved heat transfer to increase heat production. In this paper, we document our effort to develop a numerica...
Authors
Carrigan, C. et al Lawrence Livermore National Laboratory
geothermalrock mechanicshydraulic fracturingenhanced geothermal systemegssimulationhydrohydrofrackingflowmodelmodelingreservoirfracking

Utah FORGE 3-2417: Fiber-Optic Geophysical Monitoring of Reservoir Evolution 2023 Annual Workshop Presentation

Sep 08, 2023
54.51 MB
Publicly accessible
This is a presentation on the Fiber-Optic Geophysical Monitoring of Reservoir Evolution at the Utah FORGE Milford Site project by Rice University, presented by Prof. Jonathan Ajo-Franklin. The project's objective was to develop an end-to-end fiber-optic sensing approach for EGS to...
Authors
Ajo-Franklin, J. et al Rice University
geothermalenergyannual workshop2023utah forgeegsdistributed fiber optic sensingdfosdasflowing fracturesfracture creationwell pairegs performancemechanically compliant fracturesend-to-endegs fracture model

Performance, Cost, and Financial Parameters of Geothermal District Heating Systems for Market Penetration Modeling under Various Scenarios

Mar 23, 2017
Size unavailable
Publicly accessible
The U.S. Department of Energy Geothermal Vision (GeoVision) Study is currently looking at the potential to increase geothermal deployment in the U.S. and to understand the impact of this increased deployment. This paper reviews 31 performance, cost, and financial parameters as inp...
Authors
Beckers, K. and Young, K. National Renewable Energy Laboratory
geothermalenergydirect-usedistrict heatingegsgdhenhancedengineeredgeovisionhydrothermaleconomicfinancialoperation and maintenanceomcostperformancedeploymentmarket

Investigation of Stimulation-Response Relationships for Complex Fracture Systems in Enhanced Geothermal Reservoirs

Jan 01, 2011
7.34 MB
Publicly accessible
Hydraulic fracturing is currently the primary method for stimulating low-permeability geothermal reservoirs and creating Enhanced (or Engineered) Geothermal Systems (EGS) with improved permeability and heat production efficiency. Complex natural fracture systems usually exist in ...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalenhanced geothermal systemegsdiscrete fracture flowmodelingreservoir stimulationstimulationhydraulic fracturing

Utah FORGE: 2024 Annual Report on Activities and Advancements

Jan 27, 2025
19.87 MB
Publicly accessible
This 2024 annual report for Phase 3B Year 2 at Utah FORGE provides an in-depth account of activities and advancements made at the site. Key achievements include drilling and stimulating the production well 16B(78)-32, creating a geothermal reservoir, and achieving commercial-scale...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgephase 3byear 2yearly reportreportutah forge reportdrillingreservoir creationutah forge phase 3b report2024 annual reportegswell 16b78-32stimulationcirculationfiber optic monitoringdrilling technologiesseismic monitoringresearch and developmenttechnical reportannual report

Utah FORGE 2-2439v2: A Multi-Component Approach to Characterizing In-Situ Stress Final Report

Dec 22, 2025
2.43 MB
Publicly accessible
This comprehensive technical report documents a multi-component approach to in-situ stress characterization at the Utah FORGE EGS site that integrates Machine Learning (ML) methods for predicting near-well principal stresses around geothermal wells with the physics-based finite el...
Authors
Bunger, A. et al University of Pittsburgh
geothermalenergyin-situ stress estimationutah forgewave velocitythermo-poro-elastic modelingmachine learningegsnear-wellbore stressfar-field principal stressstress anisotropyphysics-based modelingfinite element modelingsonic logtuvtechnical reportreservoir characterization

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Utah FORGE: Phase-Picking Based Microseismic Event Catalog April 2024 Stimulation

Feb 19, 2026
1.73 MB
Publicly accessible
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a phase-picking workflow that integrates downhole geophones (wells 56 and 78B) and downhole DAS (well 16B). P and S-wave arr...
Authors
Zhu, W. et al University Of Utah
geothermalenergyapril 2024 stimulationforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationhydraulic fracturinggeomechanicsgeophysics

Penn State Lab Testing Fluid-Rock Interaction in Geothermal Reservoirs

Jan 01, 2018
5.53 GB
Publicly accessible
This project focused on assessment and discovery of fluid-rock interaction in geothermal reservoirs. We accomplished work in four main areas: 1) fracture formation and the relationship between fluid flow and shear failure, 2) assessment of fracture geometry and fluid permeability ...
Authors
Madara, B. et al Pennsylvania State University
geothermalenergylab testingfracture formationshear failurefluid flowfracture geometryfluid permeabilityacoustic measurementsinjectionseismicitytriaxial experimentsdynamic stressingreservoir permeabilityfracture flowpermeability evolutionacoustic fracture characterizationfrictional stabilitydynamic triggeringinjection induced seismicityinduced seismicityshear slipshear flowberea sandstonewesterly graniteegsacoustic emissionslab earthquakes

Shallow EGS Regional Resource Potential and Map Snake River Plain

Oct 30, 2020
9.83 MB
Publicly accessible
SMU Geothermal Lab developed a methodology to estimate shallow (1 km to 4 km) Enhanced Geothermal Systems (EGS) resource potential using an approach that utilizes recent geology and geophysical research along with new well data to improve the thermal conductivity model, mitigate i...
Authors
Batir, J. et al Southern Methodist University Huffington Department of Earth Sciences
geothermalenergysnake river plaintemperaturelithologyvelocityheat flowblmnrelthermal conductivityradiogenic heat productionoil and gas wellsenhanced geothermal systemegssrpshallowidahomodelmodelingradioactivityoregonbottom-hole temperatureforgepfaplay fairway analysisinterval equilibrium temperature logwell databorehole

Utah FORGE 2439: Machine Learning for Well 16A(78)-32 Stress Predictions September 2023 Report

Sep 28, 2023
3.69 MB
Publicly accessible
This task completion report documents the development and implementation of machine learning (ML) models for the prediction of in-situ vertical (Sv), minimum horizontal (SHmin) and maximum horizontal (SHmax) stresses in well 16A(78)-32. The detailed description of the experimental...
Authors
Mustafa, A. et al Battelle Memorial Institute
geothermalenergyutahforgegeomechanicsmachine learningffnnartificial neural networkannin-situ stressstress characterizationlabtuvtriaxialstressfeed forward artificial neural networkmlegsmodellingexploratory data analysiseda

Publications and Datasets from Play-Fairway Retrospective Analysis with Emphasis on Developing Improved Hydrothermal Energy Assessments

Feb 07, 2023
Size unavailable
Publicly accessible
Previous moderate and high-temperature geothermal resource assessments of the western United States utilized data-driven methods and expert decisions to estimate resource favorability. Although expert decisions can add confidence to the modeling process by ensuring reasonable mode...
Authors
Mordensky, S. et al United States Geological Survey
geothermalenergypfahydrothermalenergy assessmentresource assessmentretrospectivemachine learninggeosciencewestern usdata-drivenbias reductionfavorabilitymappingegslow tempprocessed dataresourcecharacterization

Utah FORGE 2-2439v2: Report on Predicting Far-Field Stresses Using Finite Element Modeling and Near-Wellbore Machine Learning for Well 16A(78)-32

Aug 30, 2024
973.4 kB
Publicly accessible
This report presents the far-field stress predictions at two locations along the vertical section of Utah FORGE Well 16A (78)-32 using a physics-based thermo-poro-mechanical model. Three principal stresses in far-field were obtained by solving an inverse problem based on the near-...
Authors
Lu, G. et al University of Pittsburgh
geothermalenergyutah forgein-situ stress estimationphysics-based modelingfinite element methodmachine learning modelthermo-poro-mechanical effectwell loggingvelocity-to-stress relationshipmachine learningfemreporttechnical report16a78-32mlegs2-2439v2principal stressstress predictionfar-fieldpre-cooling
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service