Search GDR Data

Showing results 1 - 25 of 207.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"land surface temperature"×
Temperature and Heat Flow×

Utah FORGE: Earth Model Mesh Data for Selected Surfaces

Dec 07, 2018
20.83 MB
Publicly accessible
This submission contains a number of data files with vertices of meshed/interpolated surfaces used in the Phase 2B earth model. Examples include land surface (based on 10-meter DEM), the granitoid-basin fill contact, several faults, and also interpolated temperature isosurfaces f...
Authors
Podgorney, R. Idaho National Laboratory
geothermalenergystudent competitionearth modelforgeroosevelt hot springsutahdemdigital elevation modelgeospatial datacoordinateisosurfacefaultstructurestructuraldatalocationland surfacetemperatureopal moundnegro magegsmilfordenhanced geothermal systemutah forgemodelingmodellingmesh datagranitoidtoptopographygeologybasin fillresourcecharacterizationprocessed data

Spatially Referenced Geodatabase for Coso Geothermal Area

Dec 01, 2022
110.41 MB
Publicly accessible
Mineral, Temperature, Gravity, and Fault Density maps in the Coso Geothermal Field in California.
Authors
Demir, E. et al Colorado School of Mines
geothermalenergygeologygeophysicsgravitytemperaturemineralgeospatialrastercosocalifornia

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Training dataset and results for geothermal exploration artificial intelligence, applied to Brady Hot Springs and Desert Peak

Sep 01, 2020
109.94 MB
Publicly accessible
The submission includes the labeled datasets, as ESRI Grid files (.gri, .grd) used for training and classification results for our machine leaning model: brady_som_output.gri, brady_som_output.grd, brady_som_output.* desert_som_output.gri, desert_som_output.grd, desert_som_outpu...
Authors
Moraga, J. et al Colorado School of Mines
geothermalenergygeothermal explorationhydrothermal mineral alterationsland surface temperaturefault densitypsinsarsubsidenceupliftbrady hot springsdesert peaknevadaconvolutional neural networkfallonmachine learningmodelhydrothermalmineraltemperaturerastergeospatial datageotifftraining datatraining dataset

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas, Part 2

Mar 01, 2019
3.53 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texasheat flowsmusouthern methodist universitymemodeep direct-usegeological variabilitytravis peakpermitreservoireastman chemicalcross-sectionsabine upliftheatflownreltxdduthermal conductivitypermittingregulatory agenciesland accesssurface watersurface heat flowgeologic variability evaluation

Areas of Weakly Anomalous to Anomalous Surface Temperature in Archuleta County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
586.5 kB
Publicly accessible
Note: This "Weakly Anomalous to Anomalous Surface Temperature" dataset differs from the "Anomalous Surface Temperature" dataset for this county (another remotely sensed CIRES product) by showing areas of modeled temperatures between 1o and 2o above the mean, as opposed to the grea...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradoarcheluta countyremote sensingasterthermal infraredarcgisgisshapefileshape filegeospatialdatathermaltemperatureanomaly detectionthermal anomaliesgeospatial data

Areas of Weakly Anomalous to Anomalous Surface Temperature in Chaffee County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
1.33 MB
Publicly accessible
Note: This "Weakly Anomalous to Anomalous Surface Temperature" dataset differs from the "Anomalous Surface Temperature" dataset for this county (another remotely sensed CIRES product) by showing areas of modeled temperatures between 1o and 2o above the mean, as opposed to the grea...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradochaffee countyasterremote sensingthermal infraredarcgisgisshapefileshape filegeospatialgeospatial datadatatemperaturethermal anomaliesanomaly detection

Areas of Weakly Anomalous to Anomalous Surface Temperature in Dolores County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
48.87 kB
Publicly accessible
Note: This "Weakly Anomalous to Anomalous Surface Temperature" dataset differs from the "Anomalous Surface Temperature" dataset for this county (another remotely sensed CIRES product) by showing areas of modeled temperatures between 1o and 2o above the mean, as opposed to the grea...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradodolores countyremote sensingasterthermal infraredarcgisgisshapefileshape filegeospatialdatatemperaturethermal anomalythermal anomaliesanomaly detectiongeospatial data

Areas of Weakly Anomalous to Anomalous Surface Temperature in Garfield County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
624.13 kB
Publicly accessible
Note: This "Weakly Anomalous to Anomalous Surface Temperature" dataset differs from the "Anomalous Surface Temperature" dataset for this county (another remotely sensed CIRES product) by showing areas of modeled temperatures between 1o and 2o above the mean, as opposed to the grea...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradogarfield countyremote sensingasterthermal infraredarcgisgisshapefileshape filegeospatialgeospatial datadatathermaltemperaturethermal anomaliesthermal anomaly

Areas of Weakly Anomalous to Anomalous Surface Temperature in Routt County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
145.6 kB
Publicly accessible
Note: This "Weakly Anomalous to Anomalous Surface Temperature" dataset differs from the "Anomalous Surface Temperature" dataset for this county (another remotely sensed CIRES product) by showing areas of modeled temperatures between 1o and 2o above the mean, as opposed to the grea...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradoroutt countyasterremote sensingthermal infraredarcgisgisshapefileshape filegeospatialdatageospatial datathermalthermal anomaliesthermal anomalytemperature

SW New Mexico Play Fairway Analysis: BHT Geothermal Gradient Calculations

Jul 24, 2015
133 kB
Publicly accessible
This file contains a compilation of BHT data from oil wells in southwestern New Mexico. Surface temperature is calculated using the collar elevation. An estimate of geothermal gradient is calculated using the estimated surface temperature and the uncorrected BHT data.
Authors
Kelley, S. New Mexico Bureau of Geology and Mineral Resources
geothermalgeothermal gradientsouthwestern new mexicobhtsw new mexicotemperaturegradientsurfacenew mexiconmsouthwestdepthresourceexplorationpfaplay fairway analysischaracterizationwell data

Areas of Weakly Anomalous to Anomalous Surface Temperature in Alamosa and Saguache Counties, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
186.89 kB
Publicly accessible
This "Weakly Anomalous to Anomalous Surface Temperature" dataset differs from the "Anomalous Surface Temperature" dataset for this county (another remotely sensed CIRES product) by showing areas of modeled temperatures between 1o and 2o above the mean, as opposed to the greater th...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradosaguache countyalamosa countyremote sensingasterthermal infraredshape filegeospatialdatageospatial layershapefilearcgisgisgeospatial dataanomaly detectiontemperaturethermal anomaly

Areas of Anomalous Surface Temperature in Archuleta County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
183.74 kB
Publicly accessible
This layer contains areas of anomalous surface temperature in Archuleta County identified from ASTER thermal data and spatial based insolation model. The temperature is calculated using the Emissivity Normalization Algorithm that separate temperature from emissivity. The incoming ...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradoarchuleta countyremote sensingasterthermal infraredarcgisgisshapefileshape filegeospatialgeospatial datadatatemperaturethermalanomaly detectionthermal anomalies

Areas of Anomalous Surface Temperature in Chaffee County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
463.96 kB
Publicly accessible
This layer contains areas of anomalous surface temperature in Chaffee County identified from ASTER thermal data and spatial based insolation model. The temperature is calculated using the Emissivity Normalization Algorithm that separate temperature from emissivity. The incoming so...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradochaffee countyasterthermal infraredremote sensingarcgisgisshapefileshape filegeospatialgeospatial datadatathermaltemperatureemissivitysolar radiation

Areas of Anomalous Surface Temperature in Dolores County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
17.98 kB
Publicly accessible
This layer contains areas of anomalous surface temperature in Dolores County identified from ASTER thermal data and spatial based insolation model. The temperature is calculated using the Emissivity Normalization Algorithm that separate temperature from emissivity. The incoming so...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradodolores countyasterremote sensingthermal infraredarcgisgusshapefileshape filegeospatialthermaltemperaturedataanomaly detectionthermal anomaliesgeospatial data

Areas of Anomalous Surface Temperature in Routt County, Colorado, as Identified from ASTER Thermal Data

Feb 01, 2012
55.72 kB
Publicly accessible
This layer contains areas of anomalous surface temperature in Routt County identified from ASTER thermal data and spatial based insolation model. The temperature is calculated using the Emissivity Normalization Algorithm that separate temperature from emissivity. The incoming sola...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradoroutt countyremote sensingasterthermal infraredarcgisgisshapefileshape filegeospatialgeospatial datasolar radiationthermal anomaliesanomaly detectiondatatemperature

Shallow EGS Regional Resource Potential and Map Snake River Plain

Oct 30, 2020
9.83 MB
Publicly accessible
SMU Geothermal Lab developed a methodology to estimate shallow (1 km to 4 km) Enhanced Geothermal Systems (EGS) resource potential using an approach that utilizes recent geology and geophysical research along with new well data to improve the thermal conductivity model, mitigate i...
Authors
Batir, J. et al Southern Methodist University Huffington Department of Earth Sciences
geothermalenergysnake river plaintemperaturelithologyvelocityheat flowblmnrelthermal conductivityradiogenic heat productionoil and gas wellsenhanced geothermal systemegssrpshallowidahomodelmodelingradioactivityoregonbottom-hole temperatureforgepfaplay fairway analysisinterval equilibrium temperature logwell databorehole

West Flank Coso FORGE: 3D Temperature Model

Mar 01, 2016
603.86 kB
Publicly accessible
x,y,z data of the 3D temperature model for the West Flank Coso FORGE site. Model grid spacing is 250m. The temperature model for the Coso geothermal field used over 100 geothermal production sized wells and intermediate-depth temperature holes. At the near surface of this model,...
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flankcosotemperaturetemperature gradientcaliforniamodel3d

Tularosa Basin Play Fairway Analysis: Weights of Evidence; Mineralogy, and Temperature Anomaly Maps

Nov 15, 2015
915.34 kB
Publicly accessible
This submission has two shapefiles and a tiff image. The weights of evidence analysis was applied to data representing heat of the earth and fracture permeability using training sites around the Southwest; this is shown in the tiff image. A shapefile of surface temperature anomali...
Authors
Brandt, A. University of Utah
geothermaltularosa basinnewmexicotexasoutcrop mineralogyasteregsweights of evidencewofepfatemperatureanomaliythermal infraredsurfaceanomaliestularosabasinnew mexicoplay fairway anlaysisoutcropmineralogygeospatial data

Brady's Geothermal Field DTS Raw Data

Mar 26, 2016
4.73 GB
Publicly accessible
The submitted data correspond to the complete raw temperature datasets captured by the distributed temperature sensing (DTS) horizontal and vertical arrays during the PoroTomo Experiment. Files in each submitted resource include: .xml (level 0): Data that includes Stokes, Anti-S...
Authors
Coleman, T. University of Wisconsin
geothermalwell datasurface datadtstemperaturenevadatrenched cablenear surface datastokesanti-stokesprobedistributed temperature sensingdistributed temperature surveynvporotomoraw data

Utah FORGE: Well 58-32 Stimulation Data

Apr 20, 2019
61.5 MB
Publicly accessible
Pressure, temperature, and flow data from open-hole, upper perforation, and lower perforation well stimulations gathered from various tools collected at well 58-32 during phase 2C.
Authors
Best, S. Geothermal Resource Group
geothermalenergyforgeutahegsmilfordroosevelt hot springspasonsurface instrumentsstimulationpressuretemperatureisolate pumpingflowbackspartek memory pt gaugememory tooldidrillgrggeothermal resource groupbridge plugbadgeropenhole stimulationdidrill survey servicesweatherford hdwell 58-32utah geothermalfracture flowreservoir stimulationhydraulic fracturingphase 2cratehydraulicflowraw dataopen-holeupper perforationlower perforationutah forge

Stanford Thermal Earth Model for the Conterminous United States

Mar 14, 2024
21.57 GB
Publicly accessible
Provided here are various forms of the Stanford Thermal Earth Model, as well as the data and methods used for its creation. The predictions produced by this model were visualized in two-dimensional spatial maps across the modeled depths (0-7 km) for the conterminous United States....
Authors
Aljubran, M. and Horne, R. Stanford University
thermal earth modeltemperaturegeothermalenergystanfordtemperature-at-depthheat flowrock thermal conductivityinterpignnphysics-informedgraph neural networksmachine learningmodeltemperature modelarcgisapimodel inputsmodel outputsdata-drivenspatial interpolationalgorithmheat conductionbottomhole temperature

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced
12345Next >>