OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 151.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"near-field"×
EGS×

Utah FORGE 2-2439v2: A Multi-Component Approach to Characterizing In-Situ Stress Final Report

Dec 22, 2025
2.43 MB
Publicly accessible
This comprehensive technical report documents a multi-component approach to in-situ stress characterization at the Utah FORGE EGS site that integrates Machine Learning (ML) methods for predicting near-well principal stresses around geothermal wells with the physics-based finite el...
Authors
Bunger, A. et al University of Pittsburgh
geothermalenergyin-situ stress estimationutah forgewave velocitythermo-poro-elastic modelingmachine learningegsnear-wellbore stressfar-field principal stressstress anisotropyphysics-based modelingfinite element modelingsonic logtuvtechnical reportreservoir characterization

Utah FORGE 2-2446: Connecting In Situ Stress and Wellbore Deviation to Near-Well Fracture Complexity using Phase-Field Simulations

Jan 30, 2025
10.44 MB
Publicly accessible
This report presents a series of numerical experiments investigating the relationships among near-well fracture complexity, in situ stress conditions, and wellbore deviation. Using a phase-field modeling approach, the study explores how factors such as stress regimes, wellbore ori...
Authors
Cusini, M. and Fei, F. Lawrence Livermore National Laboratory
geothermalenergyutah forgephase fieldnumerical simulationnear wellbore fracture nucleationegsnear-wellfracture complexityin situ stresswellbore deviationphase-field modelingnumerical solutionsfracture nucleationgeos modelingstress regimesfracture propagationrock mechanicstechnical report

Utah FORGE 2-2446: Report on Phase Field Modelling of Near-Wellbore Hydraulic Fracture Nucleation and Propagation

Dec 31, 2023
5.37 MB
Publicly accessible
This is a report that describes the modelling of fracture nucleation and propagation in the near-wellbore region to understand the relationship between in situ stress and fracture patterns. A novel phase field formulation is described here, which represents fractures as a diffuse ...
Authors
Cusini, M. and Fei, F. Lawrence Livermore National Laboratory
geothermalenergyutah forgephase fieldegsmodeltechnical reportfracture nucleationfracture propagationnear-wellborephase field modelnumerical modelgeosfracturingnumerical resultsin situ stress

Altona, NY EGS Field Site Radon Study

Sep 02, 2016
0.95 kB
Publicly accessible
Data include 222Rn activities and complimentary geochemical data for multiple field experiments as part of an EGS project
Authors
Brown, S. and Christensen, J. Lawrence Berkeley National Laboratory
geothermalenergyradontrace elementmajor elementgeochemistryegsenhanced geothermal systemgeochemicalcompositiondataradioactivityradioisotopetraceraltonanew yorknyuraniumthoriumthu222rn238u226ra228raradiumradioactiveelementaltona test sitepotsdam sandstonesandstone

Utah FORGE 2-2439v2: Report on Predicting Far-Field Stresses Using Finite Element Modeling and Near-Wellbore Machine Learning for Well 16A(78)-32

Aug 30, 2024
973.4 kB
Publicly accessible
This report presents the far-field stress predictions at two locations along the vertical section of Utah FORGE Well 16A (78)-32 using a physics-based thermo-poro-mechanical model. Three principal stresses in far-field were obtained by solving an inverse problem based on the near-...
Authors
Lu, G. et al University of Pittsburgh
geothermalenergyutah forgein-situ stress estimationphysics-based modelingfinite element methodmachine learning modelthermo-poro-mechanical effectwell loggingvelocity-to-stress relationshipmachine learningfemreporttechnical report16a78-32mlegs2-2439v2principal stressstress predictionfar-fieldpre-cooling

Utah FORGE: Regional Well Locations

Feb 22, 2018
7.42 kB
Publicly accessible
This archive contains a GIS point feature shapefile that shows the locations of wells in the general region of the Utah FORGE project, near Roosevelt Hot Springs. This includes Utah FORGE deep well 58-32 and wells for which data has been uploaded to the Geothermal Data Repository....
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgewellsspatial datagis datashapefilewell locationsroosevelt hot springswell indexarcgisgeospatial datawelllocation58-32utahegsmilfordregionalwell location

West Flank Coso FORGE: 3D Temperature Model

Mar 01, 2016
603.86 kB
Publicly accessible
x,y,z data of the 3D temperature model for the West Flank Coso FORGE site. Model grid spacing is 250m. The temperature model for the Coso geothermal field used over 100 geothermal production sized wells and intermediate-depth temperature holes. At the near surface of this model,...
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flankcosotemperaturetemperature gradientcaliforniamodel3d

Utah FORGE 2-2439v2: Reports on Stress Prediction and Modeling for Well 16B(78)-32 May 2025

Jun 05, 2025
20.34 MB
Publicly accessible
These two reports from the University of Pittsburgh document related efforts under Utah FORGE Project 2-2439v2 to estimate in-situ stresses in well 16B(78)-32 using laboratory data, machine learning models, and physics-based simulations. One report focuses on developing and valida...
Authors
Lu, G. et al University of Pittsburgh
geothermalenergyutah16b78-32in-situ stressultrasonic velocityutah forgeegs16bmachine learningtrue triaxial testingsonic logsstress predictionfar-field stressthermo-poro-mechanicalmodelingdeep learningfinite element modelgeothermal reservoirstress profilingstress anisotropytechnical report

Utah FORGE 2-2439: A Multi-Component Approach to Characterizing In-Situ Stress: Laboratory, Modeling and Field Measurement 2023 Annual Workshop Presentation

Sep 08, 2023
67.35 MB
Publicly accessible
This is a presentation on A Multi-Component Approach to Characterizing In-Situ Stress at the U.S DOE FORGE EGS Site: Laboratory, Modeling and Field Measurement project by Battelle [Columbus, OH], presented by Mark Kelley. The project's objective was to characterize stress in the U...
Authors
Kelley, M. and Bunger, A. Battelle Memorial Institute
geothermalenergyannual workshop2023utah forgeegsmachine learningin-situ stressstress characterizationmini-fracrock-core stress estimationsonic-log datamodelinglaboratory experimentsdeformation rate analysisboundary element methodsleeve frac packerfar-fieldnear-field

Utah FORGE 2-2404: The University of Oklahoma, Application of Advanced Techniques for Determination of Reservoir-Scale Stress State at Utah FORGE Final Report

Jun 30, 2025
3.73 MB
Publicly accessible
This final report summarizes the work done on Utah FORGE project 2-2404. The project aimed to develop a methodology integrating alternative well bore and core-based methods and reservoir-scale focal mechanisms (FM) to better estimate the reservoir stress at FORGE. The project obje...
Authors
Ghassemi, A. The University of Oklahoma
geothermalenergyutah forgeegswell borecore-basedfocal mechanismsreservoir stressfinal reporttechnical reportanelastic strain recoverydifferential strain curvefracture mechanicsdrilling-induced cracksnear-wellbore stress

Utah FORGE: Pressure Temperature Logs from Blundell Well 71-10, Beaver County

Oct 08, 2018
52.5 kB
Publicly accessible
This archive contains an Excel spreadsheet with pressure and temperature logs from PacifiCorp well 71-10. This well is in the Blundell Power Plant geothermal well field near Roosevelt Hot Springs, Beaver County, Utah. The spreadsheet also contains UTM coordinates for the location ...
Authors
Foster, K. Energy and Geoscience Institute at the University of Utah
geothermalenergypressure/temperature logsutahutah forgewell 71-10roosevelt hot springsbeaver countygeothermal wellgeothermal well 71-10utpressuretemperatureblundell power planttraverse surveymilfordpacificorplogswelllogforge71-10blundellwell logresourcecharacterizationegswell datawell location

Utah FORGE 2-2446: Closing the Loop Between In-situ Stress Complexity and EGS Fracture Complexity 2023 Annual Workshop Presentation

Sep 08, 2023
81.21 MB
Publicly accessible
This is a presentation on the Closing the Loop Between In-situ Stress Complexity and EGS Fracture Complexity project by Lawrence Livermore National Laboratory, presented by Dr. Matteo Cusini. The project's objective was to employ a combination of high-fidelity simulations and true...
Authors
Cusini, M. and Bunger, A. Lawrence Livermore National Laboratory
geothermalenergyannual workshop2023utah forgeegshigh-fidelity simulationstru-triaxialblock fracturing testsin-situ stresshydraulic fracture patternsfracture nucleationfracture propagationmodelingin-situ stress characterizationphase-field modelfracture simulationnear wellborefield datanumerical model

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

EPRI Report: Enhancing Geothermal Representation in EPRI's US-REGEN Model

Dec 13, 2024
1.86 MB
Publicly accessible
This report examines improvements to the representation of geothermal resources and technologies, including hydrothermal, near-field, and deep enhanced geothermal systems (EGS), in EPRI's US-REGEN capacity expansion model. Using updated datasets from the National Renewable Energy ...
Authors
Molar-Cruz, A. and Johnson, N. National Renewable Energy Laboratory
geothermalenergycapacity expansion modelegshydrothermalus-regenenergy systems modelingcarbon capture and storageccstemperature-based classificationgeothermal cost assumptionsenergy planningrenewable energytechnology assessmentresource disaggregationpower generation modelingreedseprinreltechnical report

kISMET Final Report and Highlights

Oct 31, 2016
10 MB
Publicly accessible
The files in this submission describes the results of a series of stress measurement and hydraulic fracturing experiments conducted at the Sanford Underground Research Facility (SURF) in Lead, SD. This report describes the accomplishments of the kISMET (permeability (k) and Induce...
Authors
Oldenburg, C. et al Lawrence Berkeley National Laboratory
geothermalenergystressegshydraulic fracturingnumerical modelingsanford underground research facilitycorepoorman formationanalytical modelingsubterhydraulic stimulationkismetpermeabilityinduced seismicitymanagementsurfborehole

EGS Collab: Modeling and Simulation Working Group Teleconference Series (99-128)

Jun 07, 2022
8.18 GB
Publicly accessible
This submission contains the presentation slides and recordings from EGS Collab Modeling and Simulation Working Group (MSWG) teleconferences number 99 through 128. These teleconferences served three objectives for the project: 1) share simulation results, 2) communicate field acti...
Authors
White, M. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsconferenceteleconferencerecordingmeetingpresentationscientific discussionmswgmodeling and simulation working group

Utah FORGE: Optimization of a Plug-and-Perf Stimulation (Fervo Energy)

Feb 08, 2023
6.91 MB
Publicly accessible
Information around the plug-and-perf treatment design at Utah FORGE by Fervo Energy. Objective and Purpose: Develop a multistage hydraulic stimulation approach designed specifically to target the top three factors that control the technical and commercial viability of an EGS sys...
Authors
Norbeck, J. et al Fervo Energy
geothermalenergyutah forgeplug-and-perf stimulationwell stimulationfervo energyplug-and-perfplug and perffervotechnicalassessmentfeasibilityhydraulicstimulationinjection testprocessed datablue mountainnevadaegswell 73-22well 34a-22well 34-22near-field egshorizontal drillingproppantheat in placestate of stressfiber optic sensing

Development of a Neutron Diffraction Based Experimental Capability for Investigating Hydraulic Fractures for EGS-like Conditions

Feb 01, 2013
385.75 kB
Publicly accessible
Understanding the relationship between stress state, strain state and fracture initiation and propagation is critical to the improvement of fracture simulation capability if it is to be used as a tool for guiding hydraulic fracturing operations. The development of fracture predict...
Authors
Polsky, Y. et al Oak Ridge National Laboratory
geothermalneutron diffractionstress statestrain statefracture initiationfracture simulationfracture predictionhydraulic fracturing neutron strain measurementhydraulic fracturingegshigh temperaturehigh pressurefracture

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Utah FORGE 3-2417: Simulations for Distributed Acoustic Sensing Strain Signatures as an Indicator of Fracture Connectivity

Jan 01, 2023
21.99 MB
Publicly accessible
This dataset encompasses simulations of strain signatures from both hydraulically connected and "near-miss" fractures in enhanced geothermal systems (EGS). The files and results are presented from the perspective of digital acoustic sensing's (DAS) potential to differentiate the t...
Authors
Ward-Baranyay, M. et al Rice University
geothermalenergyforgeutah forgeegsmilfordutahcomsoldfnmatlabsimulationnear-miss fracturedasdistributed acoustic sensingmodelingstrainfogmoregeophysicshydrogeomechanicssub-nanostraincodestimulation

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Utah FORGE: Area Terrain Slope Data

Dec 10, 2018
9.27 GB
Publicly accessible
This archive contains a terrain slope image, in units of degrees, of the Utah FORGE area near Roosevelt Hot springs. The data was derived from 0.5 m resolution LiDAR DEM data and is in a GeoTiff format. It was processed using ArcGIS.
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeslopeslope imageroosevelt hot springsterrain slopeslope degreesutah forgemilfordtopographylidardigital elevation modeldemgeotiffgeospatial dataarcgisgisutahterrainprocessed dataegsremote sensing

EGS Collab: Modeling and Simulation Working Group Teleconference Series (1-98)

Feb 04, 2020
11.93 GB
Publicly accessible
This submission contains the presentation slides and recordings from the first 98 EGS Collab Modeling and Simulation Working Group teleconferences. These teleconferences served three objectives for the project: 1) share simulation results, 2) communicate field activities and resul...
Authors
White, M. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsmodelingtemperatureheat flowdtstracerpressureinjection testflowc-dots

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Soil Helium R/RA Data

Mar 12, 2018
8.91 kB
Publicly accessible
This is a Helium isotope R/RA values from the Utah FORGE area near Roosevelt Hot Springs.
Authors
Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyheliumr/rahe r/rautah forgeforgesoil gasheroosevelt hot springssoil gas surveysoilisotopeutahgeochemistrysoil heliummilfordegs
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service