Search GDR Data

Showing results 1 - 13 of 13.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"protected land"×
Temperature and Heat Flow×

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Utah FORGE: Earth Model Mesh Data for Selected Surfaces

Dec 07, 2018
20.83 MB
Publicly accessible
This submission contains a number of data files with vertices of meshed/interpolated surfaces used in the Phase 2B earth model. Examples include land surface (based on 10-meter DEM), the granitoid-basin fill contact, several faults, and also interpolated temperature isosurfaces f...
Authors
Podgorney, R. Idaho National Laboratory
geothermalenergystudent competitionearth modelforgeroosevelt hot springsutahdemdigital elevation modelgeospatial datacoordinateisosurfacefaultstructurestructuraldatalocationland surfacetemperatureopal moundnegro magegsmilfordenhanced geothermal systemutah forgemodelingmodellingmesh datagranitoidtoptopographygeologybasin fillresourcecharacterizationprocessed data

Spatially Referenced Geodatabase for Coso Geothermal Area

Dec 01, 2022
110.41 MB
Publicly accessible
Mineral, Temperature, Gravity, and Fault Density maps in the Coso Geothermal Field in California.
Authors
Demir, E. et al Colorado School of Mines
geothermalenergygeologygeophysicsgravitytemperaturemineralgeospatialrastercosocalifornia

Utah FORGE: Well 16A(78)-32 Logs

Mar 08, 2021
10.01 GB
Publicly accessible
This dataset contains all well logs from Utah FORGE well 16A(78)-32. This includes the mud log, Sanvean Technologies logs, and Schlumberger logs. Please see the file descriptions below for information about each log.
Authors
Gilmour, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32 drilling logsutah forgeforgewell 16a78-32 sanvean logswell 16a78-32 schlumberger logswell 16a78-32 mud logutah geothermalwell dataloggingmud logsanvean logsschlumberger logs16a78-32well logegssanveanschlumbergerlithologyfmiformation microimagerfullborewellborecorecharacterizationdrillgeologydrill ratemineralstemperaturerate of penetrationropdrill stem test

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater

Washington Geothermal Play Fairway Analysis Heat, Permeability, and Fracture Model Data

Dec 07, 2017
283.19 MB
Publicly accessible
This submission contains raster and vector data for the entire state of Washington, with specific emphasis on the three geothermal play fairway sites: Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV), and Mount Baker (MB). Data are provided for 3 major geothermal mo...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay fairwaywashingtonmodelconfidencefavorabilityriskmtmagnetotelluricsseismicityseismicvelocityp-waves-wavegeothermometryintrusive rockspringstemperature gradientvolcanic ventsland useprocess watertransmissionurbanwatergroundwatergeophysicsfaultslipdilationtendancycoulomb shear stressslip gradientpoly3dpfashapefilesarcgisshape filegeospatial datamodelingmappingintegratedinverseinversionwashington state

Training dataset and results for geothermal exploration artificial intelligence, applied to Brady Hot Springs and Desert Peak

Sep 01, 2020
109.94 MB
Publicly accessible
The submission includes the labeled datasets, as ESRI Grid files (.gri, .grd) used for training and classification results for our machine leaning model: brady_som_output.gri, brady_som_output.grd, brady_som_output.* desert_som_output.gri, desert_som_output.grd, desert_som_outpu...
Authors
Moraga, J. et al Colorado School of Mines
geothermalenergygeothermal explorationhydrothermal mineral alterationsland surface temperaturefault densitypsinsarsubsidenceupliftbrady hot springsdesert peaknevadaconvolutional neural networkfallonmachine learningmodelhydrothermalmineraltemperaturerastergeospatial datageotifftraining datatraining dataset

Shallow EGS Regional Resource Potential and Map Snake River Plain

Oct 30, 2020
9.83 MB
Publicly accessible
SMU Geothermal Lab developed a methodology to estimate shallow (1 km to 4 km) Enhanced Geothermal Systems (EGS) resource potential using an approach that utilizes recent geology and geophysical research along with new well data to improve the thermal conductivity model, mitigate i...
Authors
Batir, J. et al Southern Methodist University Huffington Department of Earth Sciences
geothermalenergysnake river plaintemperaturelithologyvelocityheat flowblmnrelthermal conductivityradiogenic heat productionoil and gas wellsenhanced geothermal systemegssrpshallowidahomodelmodelingradioactivityoregonbottom-hole temperatureforgepfaplay fairway analysisinterval equilibrium temperature logwell databorehole

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas, Part 2

Mar 01, 2019
3.53 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texasheat flowsmusouthern methodist universitymemodeep direct-usegeological variabilitytravis peakpermitreservoireastman chemicalcross-sectionsabine upliftheatflownreltxdduthermal conductivitypermittingregulatory agenciesland accesssurface watersurface heat flowgeologic variability evaluation

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data