OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 75.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"stress directions"×
Archive×

WHOLESCALE: Mass Flux Rates for Wells at San Emidio in December 2016

Dec 01, 2016
1.79 MB
Publicly accessible
This dataset provides mass flux rates in kg/s from six (production and injection) wells at San Emidio at minute intervals from December 1, 2016 December 15, 2016. Files for injection wells are named with "IW", for instance "WellIW42-21SI.csv", and include negative flux rates. Fil...
Authors
Cardiff, M. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalgeophysicssan emidionevadamass flux ratesflow rateswell datainjectionproduction

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Utah FORGE 2439: Well 16B(78)-32 Field-Test Data from Mini-Frac Tests

Jul 02, 2023
2.73 GB
Publicly accessible
This submittal includes the field-test data collected during stress tests conducted in the Utah FORGE 16B(78)-32 wellbore to measure/characterize the stresses in the geothermal reservoir. The type of stress test performed is referred to as a mini-frac test or a micro-frac test. Th...
Authors
Kelley, M. et al Battelle Memorial Institute
geothermalenergygeomechanicsutahforgeminifracstressin-situ stressegsmini-fracstress testgeophysical logimage logacoustic logsonic logfracturinghydraulic fracturingreservoir stressinjectioncaliper logstemperature logsxmac16b78-32baker hughespacker element pressureflowbackpacker element

Geocellular model of St. Peter Sandstone for University of Illinois at Urbana-Champaign DDU Feasibility Study

Dec 31, 2018
68.79 MB
Publicly accessible
The geocellular model of the St. Peter Sandstone was constructed for the University of Illinois at Urbana-Champaign DDU feasibility study. Starting with the initial area of review (18.0 km by 18.1 km [11.2 miles by 11.3 miles]) the boundaries of the model were trimmed down to 9.7 ...
Authors
Damico, J. University of Illinois
geothermalenergyst. peter sandstoneillinois basinddudeep direct-useuniversity of illinois at urbana-champaign3-dgeocellular modelingfeasibilitycharacterizationillinois3dstructuralgeologymodelreservoirgeologicthermalhydrologicmechanicalpropertiespetrophysicalthermal conductivityspecific heat capacityheat capacityporositydensitypermeabilitythicknessdepthmt simon

Geocellular Model of Mt. Simon Sandstone for University of Illinois at Urbana-Champaign DDU feasibility study

Dec 31, 2018
111.49 MB
Publicly accessible
The geocellular model of the Mt. Simon Sandstone was constructed for the University of Illinois at Urbana-Champaign DDU feasibility study. Starting with the initial area of review (18.0 km by 18.1 km [11.2 miles by 11.3 miles]) the boundaries of the model were trimmed down to 9.7 ...
Authors
Damico, J. University of Illinois
geothermalenergygeocellular modelingmt. simon sandstoneillinois basinddudeep direct-use3-duniversity of illinois at urbana champaignfeasibilitycharacterizationillinoisstructuralgeologygeologicmodeldensityporositypermeabilitythermal conductivityheat capacitythicknessdepthst. peterthermalhydrologicmechanicalpetrophisicalproperties3dreservoir

SE Great Basin Play Fairway Analysis Heat and Permeability CRS

Nov 15, 2015
805.9 kB
Publicly accessible
Within this submission are multiple .tif images with accompanying metadata of magnetotelluric conductor occurrence, fault critical stress composite risk segment (CRS), permeability CRS, Quaternary mafic extrusions, Quaternary fault density, and Quaternary rhyolite maps. Each of th...
Authors
Brandt, A. University of Utah
geothermalutahse great basinexplorationplay fairway analysispfacrscomposite risk segmentmtcritical stresspermeabilitybasaltfaultrhyolitequaternarymapmagnetotelluricconductoroccurencefluid flowlineamentsfaultsquaternary faultsfault densityprobabilityeasterngreat basineastern great basindatageospatial data

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Chemical Fracture Detection During Triaxial Deformation Tests

Aug 19, 2025
613.72 MB
Curated
A set of triaxial tests with sandstone, limestone, and granite samples was conducted to measure fluid chemistry before, during, and after rock fracture. The dataset here includes: 1) five triaxial test data files (xlxs), 2) one file containing the measured test tube volumes for th...
Authors
Kibikas, W. Sandia National Laboratories
rock mechanicsfracture detectiongeothermalnational laboratorychemical fracture detectiontriaxial deformationsandstonelimestonegranitefluid chemistrydissolved ionsenhanced dissolutionfracture surface areafracture tracespore pressureconfining pressuredifferential stressinduced fracturereactive transport

Utah FORGE: Triaxial Direct Shear Results

Aug 14, 2023
755.67 MB
Publicly accessible
This submission contains a report and associated data from triaxial direct shear tests conducted by Los Alamos National Laboratory. The samples used were sourced from 16A(78)-32 well core. The primary objectives of this test were to determine the shear strength in both intact an...
Authors
Frash, L. et al Los Alamos National Laboratory
geothermalenergytriaxial core testingtriaxial shear testingtriaxial testinglanllos alamoscore testingcore fracture testingutah forgeutah geothermalinjectiongeochemistryegsshear strengthtriaxialpermeabilityeffluent chemistry

Fallon FORGE: Distinct Element Reservoir Modeling

Mar 12, 2018
57.97 MB
Publicly accessible
Archive containing input/output data for distinct element reservoir modeling for Fallon FORGE. Models created using 3DEC, InSite, and in-house Python algorithms (ITASCA). List of archived files follows; please see 'Modeling Metadata.pdf' (included as a resource below) for addition...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyegsforgefallonnevadastresshydro-shearinghydraulic fracturesgeomechanicsthermalmicroseismicitygeometrycirculationstimulationreservoir modelvetted-nopython codescriptmicroseimicwell trajectoriesfracture aperturehydroshearingstereonet plotspercent fracture slip vs pressureinjectionstressesdfngeologic structurejoint networkleakoff ratioshear stimulatedshear displacementnormal displacementopenholecasedthermal drawdownseismicitywell locationsreservoir mappingmiocroearthquakesmeqthermal modelingfracture tendancymicroseismicanalysisanalysesmodellingmodelreservoir

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

Washington Play Fairway Analysis Poly 3D Matlab Fault Modeling Scripts with Input Data to Create Permeability Potential Models

Feb 05, 2015
31.29 MB
Publicly accessible
Matlab scripts and functions and data used to build Poly3D models and create permeability potential GIS layers for 1) Mount St. Helens seismic zone, 2) Wind River Valley, and 3) Mount Baker geothermal prospect areas located in Washington state.
Authors
Swyer, M. AltaRock Energy Inc
geothermalexplorationprospectpoly3dstress modelpermeability potentialslip tendencydilation tendencymicro-seismicityfault modelmatlabcascade rangewind river valleyplay fairwaywashington statewashingtonfavorabilityuncertaintysensitivitylowessdisplacementdisplacement gradientmaximum coulomb shear stresssigma 3mount st. helens seismic zonemount bakerdilation tencency24k geologic fault mappingmt baker100k geologic fault mappingmodelingmodelscriptcodepermeabilityfaultstructuralfeaturesgeologypfa

Utah FORGE: Phase Native State FALCON Model Files

Jun 06, 2019
11.78 MB
Publicly accessible
The submission includes FALCON input file and mesh for the an initial pressure-temperature simulation, and a second set for pressure-temperature-displacement simulation. All simulations are steady state. Data and input for the FORGE Phase 2 native state model were compiled from hi...
Authors
Podgorney, R. Idaho National Laboratory
geothermalenergyfalconforgenative stateutahroosevelt hot springsmilfordegsenhanced geothermal systemengineered geothermal systemutah forgecodesimulationscprocessed datapreprocessed dataraw datageospatial data3-d modellinggeologytemperaturestresspressurecharacterizationmodeling3-d modelinglithologymesh fileinputslithologic contacts

Utah FORGE 3-2417: Simulation Meshes and Results from Extended Circulation and Pulse Interference Testing

Sep 05, 2025
6.17 MB
Curated
This dataset contains numerical simulation meshes and modeling results from extended circulation and pulse interference tests conducted between Utah FORGE wells 16A(78)-32 and 16B(78)-32. The simulations were performed as part of the FOGMORE Utah FORGE project (Fiber Optic MOnitor...
Authors
Lee, S. and Ghassemi, A. Rice University
geothermalenergyutah forgeegsfogmoresimulationmeshreservoir modelingextended circulation testpulse interference testnumerical simulationmesh datapressure distributiontemperature distributionpermeability modelingstress-dependent permeabilitydiscrete fracture networkdfnfiber optic monitoring16a78-3216b78-32paraviewmodelmodel filesmodel results

EGS Collab: Hydraulic Fracturing Test Measurements on the 4100L of SURF

Aug 15, 2019
21.63 MB
Publicly accessible
This package includes data from two days of testing at the Sanford Underground Research Facility (SURF) on the 4100 level. The tests were performed in borehole TV4100 in the battery charging alcove south of the Yates shaft. TV4100 is a vertical borehole ~50 meters deep. A series o...
Authors
Ingraham, M. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsblack hillsboreholestressdatapressureflowinjectioninitial shut in pressureisipfractureraw datashift reports4100linjection testheat flowrhyoliteamphibolitegeophysics

EGS Collab: Modeling and Simulation Working Group Teleconference Series (99-128)

Jun 07, 2022
8.18 GB
Publicly accessible
This submission contains the presentation slides and recordings from EGS Collab Modeling and Simulation Working Group (MSWG) teleconferences number 99 through 128. These teleconferences served three objectives for the project: 1) share simulation results, 2) communicate field acti...
Authors
White, M. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsconferenceteleconferencerecordingmeetingpresentationscientific discussionmswgmodeling and simulation working group

Eastern Great Basin Geothermal Play Fairway Analysis Report

Jun 01, 2017
111.23 MB
Publicly accessible
This is the final report for the second phase of geological, geophysical, and geochemical data collection and processing for the Eastern Great Basin Geothermal Play Fairway Analysis project.
Authors
Wannamaker, P. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutahplay fairway analysisplay fairwaygreat basineastern great basinfinal reportpfaresourceidentificationexplorationwesternutregionextensionvolcanismheatpermeabilityflowboreholemtmagnetotelluricsresistivityanomalygeochemistryfluidgasvolcaniceruptionfaultstresscriticallyseismicitygravitygeophysicsgeologictwin peaksrhyolite fieldseismicpassivenodalmappingheliumsurveyheprobability krigingcrater knolldrill holesitingcomposite riskphase 2geology

Utah FORGE: Laboratory Fault Reactivation and Permeability Evolution During Fluid Injection

Sep 15, 2025
182.35 GB
Curated
This dataset contains results from controlled shear reactivation experiments performed on cylindrical Westerly and granitoid granite samples with a single inclined fracture. Laboratory faults were pre-loaded near failure and reactivated by fluid injection to examine relationships ...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergyinduced seismicityutah forgewesterly granitegranitoidpermeabilityshear stimulationegsfault reactivationfluid injectionpermeability evolutionseismicityacoustic emissionssingle inclined fractureshear stresspore pressuretriaxial testingmechanical datageomechanicsraw dataprocessed dataacoustic data

Risk Factor Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB)

Sep 30, 2015
612.79 MB
Publicly accessible
This submission contains information used to compute the risk factors for the GPFA-AB project. The risk factors are natural reservoir quality, thermal resource quality, potential for induced seismicity, and utilization. The methods used to combine the risk factors included taking ...
Authors
E., T. Cornell University
geothermalappalachian basinwest virginianew yorkpennsylvaniadistrict heatinglow-temperaturedeep direct usecombined risk segment maprisk analysisgeothermal play fairway analysisgpfa-abpfarastershapefileshape filearcgisgisgeospatial dataseismicseismicityrisklow temperaturerisk factorplay fairway analysis

SE Great Basin Play Fairway Analysis PFA Models and Probability Map

Nov 15, 2015
763.08 kB
Publicly accessible
This submission includes a Na/K geothermometer probability greater than 200 deg C map, as well as two play fairway analysis (PFA) models. The probability map acts as a composite risk segment for the PFA models. The PFA models differ in their application of magnetotelluric conducto...
Authors
Brandt, A. University of Utah
geothermalgeothermal potentialexplorationplay fairway analysispfacomposite risk segmentcrsgreat basinutahgeothermometerna/kmodelpfa modellinggeohtermal exploration modelgoethermometergeochemistrysodiumpotassiumresource assessmenteasternseprobabilitygeothermometrymtmagnetotelluricsgeospatial datageothermal exploration modeleastern great basin

Utah FORGE: Microseismic Events

Jul 08, 2019
262.54 kB
Publicly accessible
This archive contains Excel spreadsheets containing microseismic events detected in the study area during Utah FORGE Phase 2C. The Readme file included that describes the meaning of the abbreviations used as field headers in the spreadsheets. Additionally, there is a .dat (text) f...
Authors
Rutledge, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeutah forge phase 2cutahmicroseismic eventsegsfracturereservoirstimulationmicroseismicityseismicitystressmilfordinjectionfrature networkhypocentersspectralmicroearthquakesforgephase 2croosevelt hot springsprocessed data

Washington Play Fairway Analysis Geothermal Heat and Permeability Potential Geodatabases

Dec 15, 2015
309.26 MB
Publicly accessible
This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeli...
Authors
Norman, D. et al Washington Division of Geology and Earth Resources
geothermalmount st. helens seismic zonewind river valleymount bakerpermeabilityheatfavorabilityuncertaintyrisksensitivityplay-fairwaywashingtoncascade rangeslip tendencydilation tendencysigma 3maximum coulomb shear stressdisplacementdisplacement gradientmaximum shear strain ratedilational strain ratefaultvolcanic ventintrusive rocktemeprature gradientgeothermometryhot springfumarolegeothermal favorabilitystrain rategisarcgisgeospatial datageodatabasegdbwashington statepfa

EGS Collab: Modeling and Simulation Working Group Teleconference Series (1-98)

Feb 04, 2020
11.93 GB
Publicly accessible
This submission contains the presentation slides and recordings from the first 98 EGS Collab Modeling and Simulation Working Group teleconferences. These teleconferences served three objectives for the project: 1) share simulation results, 2) communicate field activities and resul...
Authors
White, M. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsmodelingtemperatureheat flowdtstracerpressureinjection testflowc-dots

Washington Play Fairway Analysis Poly 3D Matlab Fault Modeling Scripts with Input Data to Create Permeability Potential Models

May 01, 2017
8.73 MB
Publicly accessible
Matlab scripts and functions and data used to build Poly3D models and create permeability potential layers for 1) St. Helens Shear Zone, 2) Wind River Valley, and 3) Mount Baker geothermal prospect areas located in Washington state.
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpoly3dstress modelpermeability potentialfault modelmatlabwind river valleymount bakerst. helens shear zonemount st. helenswashington statesite assessmentresource assessmentinvestigationpfa

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater
<< Previous123Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service