OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 425.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"point data"×
Archive×

Gravity Data for West-Central Colorado

Apr 06, 2012
164.99 MB
Publicly accessible
Modeled Bouger-Corrected Gravity data was extracted from the Pan American Center for Earth and Environmental Studies Gravity Database of the U.S. at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was open...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalgravitybougercoloradoshapefilepoint shapefileline shapefileshape filegisarcgisgeospatialcontourwestcentralwest-centraldatageospatial data

Ground Magnetic Data for West-Central Colorado

Mar 08, 2012
303.47 MB
Publicly accessible
Modeled ground magnetic data was extracted from the Pan American Center for Earth and Environmental Studies database at http://irpsrvgis08.utep.edu/viewers/Flex/GravityMagnetic/GravityMagnetic_CyberShare/ on 2/29/2012. The downloaded text file was then imported into an Excel sprea...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalcoloradomagneticsshapefilewestcentralwest-centralshape filegisarcgisgeospatialmagneticfield strengthpoint shapefilegrounddatageospatial data

Nevada Great Basin Play Fairway Analysis Steptoe Valley

Oct 29, 2015
386.81 MB
Publicly accessible
All datasets and products specific to the Steptoe Valley model area. Includes a packed ArcMap project (.mpk), individually zipped shapefiles, and a file geodatabase for the northern Steptoe Valley area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basinsteptoe valleybasinarcmapspreadsheetgeologic mapwell dataseismic reflectionseismic linesgravityshapefile3d modelgeodatabasearcgisgisgeospatial datageologygeophysicsmappfaplay fairway analysisnv great basin

Utah FORGE: Regional Well Locations

Feb 22, 2018
7.42 kB
Publicly accessible
This archive contains a GIS point feature shapefile that shows the locations of wells in the general region of the Utah FORGE project, near Roosevelt Hot Springs. This includes Utah FORGE deep well 58-32 and wells for which data has been uploaded to the Geothermal Data Repository....
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgewellsspatial datagis datashapefilewell locationsroosevelt hot springswell indexarcgisgeospatial datawelllocation58-32utahegsmilfordregionalwell location

Penrose Well Temperatures

Mar 15, 2013
6.69 kB
Publicly accessible
Penrose Well Temperatures Geothermal waters have been encountered in several wells near Penrose in Fremont County, Colorado. Most of the wells were drilled for oil and gas exploration and, in a few cases, production. This ESRI point shapefile utilizes data from 95 wells in and a...
Authors
Christopherson, K. Flint Geothermal, LLC
geothermalcoloradofremont countytemperature gradientsoil and gas wellstemperature gradientpoint shapefileshapefileshape filewell datatemperaturepenrose welldatageospatial data

Hawthorne Nevada Deep Direct-Use Feasibility Study References, Reports, Literature

Mar 29, 2018
189.25 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorneel capitandrillingwell datadrilling data

Tularosa Basin Play Fairway Analysis: Groundwater, Heat Flow, Relief Map

Nov 15, 2015
263.37 MB
Publicly accessible
In this submission is the groundwater composite risk segment (CRS) used for play fairway analysis. Also included is a heat flow probability map, and a shaded relief map of the Tularosa Basin, NM.
Authors
Brandt, A. University of Utah
geothermaltularosabasingroundwatercrscomposite risk segmentshaded reliefprobabilityheatflowheatflowmapfort blissmcgregor rangenew mexiconewmexicoshadedreliefpfaplay fairway analysisshapefileshape filegisarcgisgeospatial data

Geothermal Geodatabase for Rico Hot Springs Area and Lemon Hot Springs, Dolores and San Miguel Counties, Colorado

Nov 01, 2012
524.95 MB
Publicly accessible
This geodatabase was built to cover several geothermal targets developed by Flint Geothermal in 2012 during a search for high-temperature systems that could be exploited for electric power development. Several of the thermal springs have geochemistry and geothermometry values indi...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalricocoloradogeodatabasedolores countysan miguel countygeochemistrystructuralpoint informationmines and prospectsreconnaissanceshallow temperature surveyair photo lineamentstravertinegroundwaterland ownershipgeologygeologic maprico quadrangletopographicmapgeothermometrygeospatial datadatagis

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

Fallon FORGE: 3D Geologic Model

Mar 01, 2018
949.28 kB
Publicly accessible
The 3D geologic model for the Fallon for site was constructed in EarthVision software using methods similar to (Moeck et al., 2009, 2010; Faulds et al., 2010b; Jolie et al., 2012, 2015; Hinz et al., 2013a; Siler and Faulds, 2013; Siler et al., 2016a, b) References are included in ...
Authors
Blankenship, D. and Siler, D. Sandia National Laboratories
geothermalenergyforgeegsgeologymodelearthvisionfaultsstratigraphyvetted-no3dfallonnv3d modelingfaultingstructurenevadamodellinggeologic

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

Shallow (2-meter) Temperature Surveys in Colorado

Feb 01, 2012
10.72 kB
Publicly accessible
Shallow temperature surveys are useful in early-stage geothermal exploration to delineate surface outflow zones, with the intent to identify the source of upwelling, usually a fault. Detailed descriptions of the 2-meter survey method and equipment design can be found in Coolbaugh ...
Authors
E., R. Flint Geothermal, LLC
geothermalshallow temperature surveyscoloradoshallow temperature surveyarcgisgisshapefileshape filegeospatialdatageospatial dataexplorationremote sensinganomaly detectionfault detectiontemperatureupflow faultfault

Structural Orientations Adjacent to Some Colorado Geothermal Systems

Feb 01, 2012
8.62 kB
Publicly accessible
Structural orientations (fractures, joints, faults, lineaments, bedding orientations, etc.) were collected with a standard Brunton compass during routine field examinations of geothermal phenomena in Colorado. Often multiple orientations were taken from one outcrop. Care was taken...
Authors
, R. Flint Geothermal, LLC
geothermalcoloradofaultsstructurearcgisgisshapefileshape filegeospatialgeospatial datadatafracturesbedding orientationlineamentsgeology

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

Sedimentary Geothermal Feasibility Colorado Well Database

Oct 31, 2019
159.42 MB
Publicly accessible
Well data were mined from Geothermal Prospector (GTP), Southern Methodist University (SMU), the Colorado Oil and Gas Conservation Commission (COGCC), and the Colorado Geological Survey (CGS). The well data gathered was then used to assess sedimentary geothermal feasibility in the ...
Authors
Taverna, N. National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitywell datatemperatureformationdepthsedimentary basingeospatial datahugoton embaymentnorth park basinparadox basinpiceance basinraton basindenver basinsand wash basinsedgeocgsgtpcogccshapefile

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

EGS Collab Experiment 1: Baseline Cross-well Seismic

Apr 30, 2018
2.13 GB
Publicly accessible
As part of the geophysical characterization suite for the first EGS Collab tesbed, here are the baseline cross-well seismic data and resultant models. The campaign seismic data have been organized, concatenated with geometry and compressional (P-) & and shear (S-) wave picks, and ...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergygeophysicsseismiccross-wellsgysegymodeldataresultsvelocityp-waves-waveelastic modulivisualizationcalculationinversionhydrofractureexperimentsurfsanford underground research facilityegsenhanced geothermal systemcollabboreholebaselinedensityshearbulkyoungsmodulusmodulistimulationhydraulicegs collab

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

Lightning Dock Geothermal Field Data Package, Hidalgo County, New Mexico

Aug 19, 2026
7.4 GB
Publicly accessible
This submission is a curated geoscience, well and plant-operations data package for the Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico, a liquid-dominated system produced for binary (ORC) power generation. It covers well-by-well data...
Authors
Ifrene, G. et al Zanskar Geothermal
lightning dockwell logsgisproduction datageothermalenergytracer testpower generationgeochemistrygeophysicsgroundwaterbinary systemorcdownhole temperaturebouguermagnetotelluricinversion modelsaeromagneticsgravity surveylidarquaternary faultgeologymud logstemperature

Brady's Geothermal Field March 2016 Vibroseis SEG-Y Files and UTM Locations

Mar 31, 2016
982.28 GB
Publicly accessible
PoroTomo March 2016 Updated vibroseis source locations with UTM locations. Supersedes gdr.openei.org/submissions/824. Updated vibroseis source location data for Stages 1-4, PoroTomo March 2016. This revision includes source point locations in UTM format (meters) for all four Stage...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisegsactive seismicsurveymetadatasweep datasource locationsutmactive sourcetruckgeophysicsgeophysicalsegyseismic datadasdasv

Utah FORGE: 2024 Discrete Fracture Network Model Data

Sep 08, 2024
1.4 GB
Publicly accessible
The Utah FORGE 2024 Discrete Fracture Network (DFN) Model dataset provides a set of files representing discrete fracture network modeling for the FORGE site near Milford, Utah. The dataset includes four distinct DFN model file sets, each corresponding to different time frames and ...
Authors
Finnila, A. and Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedfndiscrete fracture modellingfracturesstochastic fracturestensile fracturesdiscrete fracture network modelegsplanar fracturespermeabilityporositycompressibilitystoragemeqhydraulic stimulationmodelmodelingprocessed data
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service