Search GDR Data

Showing results 76 - 100 of 210.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"utah geological survey"×
Data×

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data

Hawaii Play Fairway Analysis: Hawaii Island Groundwater Flow Model

Jan 01, 2015
12.34 MB
Publicly accessible
Groundwater flow model for Hawaii Island. Data is from the following sources: Whittier, R.B., K. Rotzoll, S. Dhal, A.I. El-Kadi, C. Ray, G. Chen, and D. Chang. 2004. Hawaii Source Water Assessment Program Report Volume II Island of Hawaii Source Water Assessment Program Report. P...
Authors
Lautze, N. University of Hawaii
geothermalgroundwater flow modelhawaii islandhawaiigroundwaterwater tableaquiferwatervelocityvelocitiesflowmodelpfa

Hawaii Play Fairway Analysis: East Maui Groundwater Flow Model

Jan 01, 2015
11.48 MB
Publicly accessible
Groundwater flow model for East Maui. Data is from the following sources: Whittier, R. and A.I. El-Kadi. 2014. Human and Environmental Risk Ranking of Onsite Sewage Disposal Systems For the Hawaiian Islands of Kauai, Molokai, Maui, and Hawaii Final. Prepared by the University...
Authors
Lautze, N. University of Hawaii
geothermalgroundwater flow modeleast mauimauihawaiigroundwaterflowmodelaquiferwater tablewatervelocityvelocitiespfa

Hawaii Play Fairway Analysis: Kauai Groundwater Flow Model

Jan 01, 2015
8.86 MB
Publicly accessible
Groundwater flow model for Kauai. Data is from the following sources: Whittier, R. and A.I. El-Kadi. 2014. Human and Environmental Risk Ranking of Onsite Sewage Disposal Systems For the Hawaiian Islands of Kauai, Molokai, Maui, and Hawaii Final. Prepared by the University of H...
Authors
Lautze, N. University of Hawaii
geothermalgroundwater flow modelkauaihawaiigroundwaterflowmodeldataaquiferwaterwater tablevelocityvelocitiespfa

Hawaii Play Fairway Analysis: West Maui Groundwater Flow Model

Jan 01, 2015
25.53 MB
Publicly accessible
Groundwater flow model for West Maui. Data is from the following sources: Whittier, R. and A.I. El-Kadi. 2014. Human and Environmental Risk Ranking of Onsite Sewage Disposal Systems For the Hawaiian Islands of Kauai, Molokai, Maui, and Hawaii Final. Prepared by the University...
Authors
Lautze, N. University of Hawaii
geothermalgroundwater flow modelwest mauimauihawaiigroundwaterflowmodelaquiferwater tablewatervelocityvelocitiespfa

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Hawaii Play Fairway Analysis: Oahu Groundwater Flow Model

Jan 01, 2015
11.39 MB
Publicly accessible
Groundwater flow model for the island of Oahu. Data is from the following sources: Rotzoll, K., A.I. El-Kadi. 2007. Numerical Ground-Water Flow Simulation for Red Hill Fuel Storage Facilities, NAVFAC Pacific, Oahu, Hawaii Prepared TEC, Inc. Water Resources Research Center, Univer...
Authors
Lautze, N. University of Hawaii
geothermalgroundwater flow modeloahuhawaiigroundwateraquiferwaterwater tableflowvelocityvelocitiesmodelpfa

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

Exploration Gap Assessment (FY13 Update)

Sep 30, 2013
987.34 MB
Publicly accessible
This submission contains an update to the previous Exploration Gap Assessment funded in 2012, which identify high potential hydrothermal areas where critical data are needed (gap analysis on exploration data). The uploaded data are contained in two data files for each data catego...
Authors
Esposito, A. et al National Laboratory of the Rockies
geothermalshapefilegapnrelgap assessmentngdsnational geothermal data systemgeothermal prospectorwell datageologic mapsfault mapsgeochemistry datadata coveragedata gapswestern usdbase fileexplorationmineralraw dataindex filegeophysicalprojection filewellgeologicstructurestructural mapsgeochemistryfaultpaperprocesssgwstanford geothermal workshopgeospatial data

EGS Collab Experiment 2: Laser Scanned 4100 L Drift Map

Dec 19, 2019
1.26 GB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergylaser scanned drift mapsurfegs collabhydraulic shearingsanford underground research facilityhydraulic fracturingegslaser scanneddrift mapyates shaftbattery charging stationlaser surveytestbed 2experiment 2autocadleapfrogpoint cloudmapremote sensing

Brady's Geothermal Field Active Source Seismic Survey MetaData

Mar 28, 2016
2.03 MB
Publicly accessible
Sweep parameters, source locations and trigger timing for the four Phases of active source seismic data acquisition.
Authors
Robertson, M. University of Wisconsin
geothermalbrady geothermalactive sourceegsvibroseisseismicsource locationtrigger timegeophysicsgeophysicalporotomo

Subsurface Geological Information and Models in support of Feasibility Study of Direct District Heating for the Cornell Campus Utilizing Deep Geothermal Energy

Oct 27, 2019
3.29 MB
Publicly accessible
This purpose of this set of entries is to group together the materials and analytical methods used in the assessment of the natural rock properties within and surrounding two potential reservoirs.
Authors
Jordan, T. et al Cornell University
geothermalenergycornell universitylow-temperature geothermalreservoir simulationuncertainty analysisdistrict heatingdirect useappalachian basinnew york statetechno-economic analysislevelized cost of heat lcohexternality valuesenvironmental valueeconomic valueddueaenvironmentenvironmentalassessmenttemperaturelcohlevelized cost of heateffective porosityheat pumpghpwell datacharacterizationshale neutron porositycornell

EGS Collab Experiment 2: Preliminary Test Wells Locations and Orientations

Dec 19, 2019
233.95 kB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergysurfegs collabgyro datahydraulic fracturinghydraulic shearingsanford underground research facilitywell locationswellstestbed 2lidarremote sensingegsexperiment 2well locationwell orientationsigma-vtest wellswell dataleapfroghomestake mineboreholegyrocollar location

US Geothermal Electricity and Heat Market Analysis and Report

Jun 30, 2020
43.06 kB
Publicly accessible
The power production data from FY19 is provided for U.S. geothermal power plants. The spreadsheet includes the plant name and type, nameplate capacity, summer capacity, winter capacity, and net generation for each power plant.
Authors
Robins, J. et al National Renewable Energy Laboratory
geothermalenergynameplate capacitysummer capacitywinter capacitymean net generationnet generationpower productionpowerplant typegeothermal risingdouble flashdry steamtriple flashsingle flashbinarygrcgeothermal resources council

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas

Jun 28, 2018
20.79 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texastravis peaksabine uplifthosstonsligocotton valleylongvieweastman chemicalreservoir productivity indexrpiheatflowheat flowsmusouthern methodist universitynrelbottom hole temperaturebhtabsorption chillpresentationmemodatapaperpublicationjournal articleddutxfeasibilitydeep direct-use

Deep Direct-Use Feasibility Study Computed Tomography (CT)-scanned data Analysis for the Tuscarora Sandstone at the National Energy Technology Laboratory

Jan 10, 2020
40.99 GB
Publicly accessible
The computed tomography (CT) facilities at the National Energy Technology Laboratory (NETL) Morgantown, West Virginia site were used to characterize core of the Tuscarora Sandstone from a vertical well in Preston County WV, the Preston-119 from a depth of 7,165 to 7,438 ft. The pr...
Authors
Brown, S. et al West Virginia University
geothermalenergyappalachian basinwvuwvgestuscarora sandstonecomputed tomographyimage jctct scannercharacterizationcore sampleslithologydensity valuesddudeep direct usefeasibilitycorepres-119preston 119clay 513harrison 79fracture volume

Utah FORGE: Earthquake Catalog

Mar 21, 2018
66.71 kB
Publicly accessible
This is the set of earthquake catalogs developed for the Utah FORGE project covering December of 2016 through March of 2018. These are discussed in the "Utah FORGE Phase 2B Final Topical Report," which can be found on GDR under id: 1038 (See link 'Final Topical Report' in resource...
Authors
Pankow, K. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge seismicityseismicityearthquakeearthquakesgeospatial dataearthquake catalogsutah forge earthquake catalogsutahutah forgeutah forge 2broosevelt hot springsmilfordforgephase 2bmicroseismicitymonitoringseismicmicroseismicegsprocessed datareportcatalogresourcecharacterization

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

Analysis of Geothermal Resources in Three Texas Counties

Oct 30, 2020
37.52 MB
Publicly accessible
This project updates the geothermal resources beneath our oil and gas fields, as part of the research for the Texas GEO project. This report "Analysis of Geothermal Resources in Three Texas Counties" (October 2020) improves on previous mapping of the Texas resources for the counti...
Authors
Richards, M. and Batir, J. Southern Methodist University Huffington Department of Earth Sciences
geothermalenergytexas geobottom hole temperatureradiogenic heat productionthermal conductivity10 kmjackson county txcrockett county txwebb county txoil and gas wellstexasjackson countycrockett countywebb countyoil and gaswell dataformation temperaturetemperaturestratigraphyformationlithologytemperature gradientheat flowradiogenicmapborehole

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Utah FORGE: Well 78-32 Capacity Test

Jun 20, 2019
12.52 kB
Publicly accessible
This dataset includes an Excel spreadsheet with Utah FORGE Phase 2c Well 78-32 capacity data. It also includes a readme file discussing the data which also includes the well coordinates.
Authors
Kirby, S. and Gall, R. Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32 capacityutah forgeutah geothermalsystems anyalysisforgeutahcapacity testwell 78-32flowdrawdowndtwegsmilfordroosevelt hot springsmodelfielddatawell testcapacityaquifermodellingwell78-32phase 2clocation

Utah FORGE: Rock Properties

Apr 07, 2018
32.28 MB
Publicly accessible
This is an Excel spreadsheet that contains rock properties from several wells in the Utah FORGE study area. This includes a map of the wells. Data is described in the Final Topical Report included in the resources below.
Authors
Gwynn, M. Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgerock propertiesroosevelt hot springsroosevelt hot springs rock propertiesresistivitytemperature plotsgammasonicdensityvelocitycaliperporositymaficslocation mapdrilling datalog responsequartzbulk densityksparmagnetic susceptibilitycorerock propsutahrockpropertieswell dataresourcecharacterizationgeomechanicsegsmilford

Utah FORGE: North Milford Groundwater Geochemistry

Jun 20, 2019
1.06 MB
Publicly accessible
This dataset contains groundwater geochemistry from several wells in North Milford Valley, Utah, in the region of the Utah FORGE project (Phase 2c). Readme file that discusses the data contained in the Excel spreadsheet. Data include GPS coordinates (UTM, Lat-Long), sampling tempe...
Authors
Simmons, S. and Kirby, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegroundwaternorth milford valleygeochemistrygroundwater geochemistrywater chemistryforgeutahsamplingmilfordegsisotopetemperatureroosevelt hot springsion balancegwgeospatial dataresourcecharacterization

Utah FORGE: Site Earthquake Animation

Mar 13, 2016
1.14 MB
Publicly accessible
This is a .kml earthquake animation covering the period of 1991 2011 for the Utah Milford FORGE site. It displays seismic events using different sized bubbles according to magnitude. It covers the general Utah FORGE area (large shaded rectangle) with the final site displayed as a ...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgeegsearthquakesgeospatialsimulationseismologyarcgisgoogle earthseismicityseismic monitoringbackgroundutahgeospatial dataearthquakeanimationtime lapseeventmagnitude

Critical Elements in Produced Fluids from Nevada and Utah

Jul 27, 2017
5.6 MB
Publicly accessible
Critical elements and related analytical data for produced fluids from geothermal fields in Nevada and Utah, Sevier thermal belt hot springs, Utah, and Uinta basin oil-gas wells, Utah are reported. Analytical results include pH, major species, trace elements, transition metals, ot...
Authors
Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergycritical elementsproduced fluidsnevadautahcoproduced resourceoil and gasreemetalsmetalloidspatuasan emidouinta basingeochemistrybrinecoproduced
<< Previous12345678Next >>