OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 76 - 100 of 289.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"well depth"×
Data×

Hawthorne Nevada Deep Direct-Use Feasibility Study Navy Geothermal Program Office General Data

Mar 29, 2018
693.88 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorne

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Energy Return On Investment of Engineered Geothermal Systems Data

Jan 01, 2012
1.05 MB
Publicly accessible
The project provides an updated Energy Return on Investment (EROI) for Enhanced Geothermal Systems (EGS). Results incorporate Argonne National Laboratory's Life Cycle Assessment and base case assumptions consistent with other projects in the Analysis subprogram. EROI is a ratio o...
Authors
Mansure, C. Arthur Mansure
geothermalenergyinvestmentreturnpaybackengineeredenergy return on investmentengineered geothermal systemenhanced geothermal systemefficiencyegseroicasingcementdiameterdepthgeteminputswellsnettruckingfuelmaterialsbentonitepolymerseconomicsassessmenteconomic

Deep Direct-Use Feasibility Study Tuscarora Sandstone Geophysical Log Digitization

Dec 18, 2019
281.37 MB
Publicly accessible
This dataset contains well log files collected from wells penetrating the Tuscarora Sandstone, structural geologic map of West Virginia and salinity information based on brine geochemistry in West Virginia and Pennsylvania. A combination of proprietary and free software may be re...
Authors
Moore, J. West Virginia University
geothermalenergywvgeswvudduappalachian basintuscarora sandstonewell logsdeep direct-usegeochemistrygiswell datadigitizationstructural mapbrine geochemistrysalinity infomationfeasibilitypropertiesthicknessdepthdensitypermeabilityegsgeospatial data

Renewable Energy Potential Model: Hawaii Geothermal Supply Curves

Jan 13, 2025
102.89 kB
Publicly accessible
This dataset extends the development of the Renewable Energy Potential (reV) model to include geothermal energy, with a specific focus on Hawaii. Provided here are the results of two scenarios that were modeled for geothermal energy in Hawaii: binary enhanced geothermal systems (E...
Authors
Trainor-Guitton, W. et al National Renewable Energy Laboratory
geothermalenergysupply curvegeospatialhawaiirevlevelized cost of energyhydrothermalcapital costgeothermal locationlcoeegspfaplay fairwaysimulationmodelmodel resultsheat mapbinary egsbinary hydrothermaltransmissiongrid connectiondevelopmentfeasibilityproduction metricssupply curves

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas

Jun 28, 2018
20.79 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texastravis peaksabine uplifthosstonsligocotton valleylongvieweastman chemicalreservoir productivity indexrpiheatflowheat flowsmusouthern methodist universitynrelbottom hole temperaturebhtabsorption chillpresentationmemodatapaperpublicationjournal articleddutxfeasibilitydeep direct-use

Hawaii Play Fairway Analysis: Lanai Resistivity and Density 3D Inversion Models

Jun 01, 2020
42.2 MB
Publicly accessible
To prepare for its third phase, the Hawaii Play Fairway project conducted groundwater sampling and analyses in ten locations in the Hawaiian islands, magnetotelluric (MT) and gravity surveys, as well as calculations of 3D subsurface stress due to the weight of the rock underlying ...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaimagnetotelluricgravityhaleakalamauimauna keamtmasurveydatateststresssubsurfacevolcanoresistivitydensityfracture induced permeabilityegsenhanced geothermal systemresourcepotentialresource probabilityexploratory drilling

New River Geothermal Exploration (Ram Power Inc.)

Nov 15, 2013
675.7 MB
Publicly accessible
The New River Geothermal Exploration (DOE Award No. EE0002843) is located approximately 25km south of the Salton Sea, near town of Brawley in Imperial County and approximately 150km east of San Diego, California. A total of 182 MT Logger sites were completed covering the two sepa...
Authors
Mirza, R. and Data, E. Ram Power, Inc.
geothermalmagnetotelluric surveymt surveyresistivitymesquitenew rivernorth americaimperial countyelectronic data exchangeedispacial modelspacial modelingsdmseismic reflection surveyfaultsbrawleycaliforniareportsite namesdaily survey notesparallel sensor testspatial modelingsurvey files1ddepth profilesresistivity models2d3ddepth plan mapsmapsgeosoftgeophysical modeling toolsgeotoolsgocadsoftwareappendixvibration monitoringsurvey notesgeospatial data

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa

Geothermal Reservoir Simulation Results in support of Feasibility Study of Direct District Heating for the Cornell Campus Utilizing Deep Geothermal Energy

Oct 29, 2019
1.62 GB
Publicly accessible
This dataset contains input data, code, ReadMe files, output data, and figures that summarize the results of a stochastic analysis of geothermal reservoir production from two potential geothermal reservoirs that were evaluated for the Cornell University Deep Direct-Use project. Th...
Authors
Smith, J. and Beckers, K. Cornell University
geothermalenergycornell universitylow-temperature geothermalreservoir simulationuncertainty analysistechno-economic analysisdirect-use heatingdistrict heatingnew york stateheat pumpslevelized cost of heat lcohexternality valuesenvironmental valueeconomic valuedirect usedducornelltrenton-black rivertough2petrasimmonte carlo analysismonte carlogeophiresstochastic analysis

Environmental Life Cycle Assessment Spreadsheet tool for Deep Direct-Use Geothermal at the University of Illinois at Urbana-Champaign Campus

Jan 31, 2020
101.49 kB
Publicly accessible
A Life Cycle Assessment (LCA) spreadsheet tool was developed to analyze potential environmental benefits of a deep direct-use (DDU) geothermal energy system (GES) at the University of Illinois at Urbana-Champaign (U of IL) campus. The LCA spreadsheet tool is a unique contribution ...
Authors
Tinjum, J. et al University of Illinois
geothermalenergydeep direct-usedduillinois basinsedimentary basinlow-temperatureagrcicultural research facilitieslife cycle assessmentlcaspreadsheet toolcradle-to-grave environmental impactsfeasibilitylife cycleassessmentenvironmentenvironmentalimpactbenefittooluniversity of illinoischampagne urbana

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

Maui Gravity and Soil Gas Surveys

Apr 01, 2010
1.37 MB
Publicly accessible
Contains a ground-based gravity survey of South Maui and a series of soil CO2 flux and temperature surveys encompassing Maui and the Big Island. The gravity survey was collected from approximately 284 km2 and consisted of 400 gravity stations with 400 m spacing. Locations were de...
Authors
Akerley, J. Ormat Nevada Inc
geothermalgravitymauigeophysicsbouger anomalysoil fluxgeochemistrysoil gastemperaturehawaiibig island

Utah FORGE: Phase 1a Tensor Strainmeter Data for the April, 2022 Stimulation of Well 16A(78)-32

Sep 15, 2022
26.41 MB
Publicly accessible
Data from two Tensor Optical Fiber Strainmeters that were operational during Stages 1, 2, and 3 of the April, 2022 stimulation of well 16A(78)-32. Each csv file contains data from each stimulation stage (stage1, stage2, stage3) for both Phase 1a strainmeter installations (FS01, f...
Authors
DeWolf, S. and Murdoch, L. Clemson University
geothermalenergystrainstrainmeterutah forgetensor strainwell 16a78-32 stimulationstimulationforgefiberopticalegs

Utah FORGE: Neubrex Well 16B(78)-32 DAS Data April 2024

Oct 01, 2024
97.48 TB
Publicly accessible
This dataset comprises Distributed Acoustic Sensing (DAS) data collected from the Utah FORGE monitoring well 16B(78)-32 (the producer well) during hydraulic fracture stimulation operations conducted in April 2024. The data were acquired continuously over the stimulation period at ...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergydasacoustic sensingmicroseismiccrosswell strain ratefracture driven interactionsfdidistributed acoustic sensinginjection allocationstrain rateutah forgeegsstimulation16b 78-3216a 78-32mircroseismicityneubrexraw datahdf5h5time gated

United States Geothermal Supply Curves 2024

Apr 15, 2025
627.1 MB
Publicly accessible
This data packet contains supply curves and a composite siting exclusion TIFF for EGS and hydrothermal geothermal across the contiguous United States. The supply curves offer comprehensive metrics such as capacity (MW), generation (MWh), levelized cost of energy (LCOE), levelized ...
Authors
Trainor-Guitton, W. et al National Renewable Energy Laboratory
energypowerenergy analysisgeothermalegsenhanced geothermal systemshydrothermalrevsupply curvecost of energycost of transmissiongeothermal powerrev siting labssitinglabsiting labsupply curvesunited states2024hourly generationsitingcapacitygenerationpower profiles

Utah FORGE: Well 16A(78)-32 Logs

Mar 08, 2021
10.01 GB
Publicly accessible
This dataset contains all well logs from Utah FORGE well 16A(78)-32. This includes the mud log, Sanvean Technologies logs, and Schlumberger logs. Please see the file descriptions below for information about each log.
Authors
Gilmour, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 16a78-32 drilling logsutah forgeforgewell 16a78-32 sanvean logswell 16a78-32 schlumberger logswell 16a78-32 mud logutah geothermalwell dataloggingmud logsanvean logsschlumberger logs16a78-32well logegssanveanschlumbergerlithologyfmiformation microimagerfullborewellborecorecharacterizationdrillgeologydrill ratemineralstemperaturerate of penetrationropdrill stem test

Low-Temperature Hydrothermal Resource Potential Estimate

Jun 30, 2016
2.79 MB
Publicly accessible
Compilation of data (spreadsheet and shapefiles) for several low-temperature resource types, including isolated springs and wells, delineated area convection systems, sedimentary basins and coastal plains sedimentary systems. For each system, we include estimates of the accessible...
Authors
Mullane, M. et al National Renewable Energy Laboratory
geothermalhydrothermallow-temperaturedirect usespringswellsdelineated areasedimentary basinaccessible resource basemean extractable resourcebeneficial heatusgsresource potentialcoastal plainslow temperatureegsdepthshallow temperauteconvectionconductioncoastal plainisolatednrelsmubottom-hole-temperaturetemperature datadepth dataisolated systemshapefilegis data

Hawthorne Nevada Deep Direct-Use Feasibility Study Data Used for Geothermal Resource Conceptual Modeling and Power Capacity Estimates

Apr 05, 2020
4.1 MB
Publicly accessible
This data submission includes several data components that were used to develop a conceptual model and power capacity-estimates of two low-temperature geothermal resources that define geothermal prospect A at Hawthorne, Nevada. Data are sourced from a combination of legacy publicl...
Authors
Ayling, B. and Hinz, N. Great Basin Center for Geothermal Energy
geothermalenergyhawthornegeochemistryconceptual modeltemperature logsborehole fracture datahawthorne army depotdirect usenevada2-meter temperaturesalteration mineralsptswell datafluid chemistryddutemperaturefracturexrdwater chemistrysurveycuttingsmodelingcapacityestimatesconceptualhwaad-2hwaad-3hwaad-2ageospatial datalow-tempertaurehydrothermalseservoireservoir compartmentalizationpower capacityimage log

Advanced Sorbent Structure Recovery of REEs, Precious Metals and Other Valuable Metals from Geothermal Waters and Its Associated Technoeconomics

May 25, 2017
483.89 kB
Publicly accessible
This work evaluates, develops and demonstrates flexible, scalable mineral extraction technology for geothermal brines based upon solid phase sorbent materials with a specific focus upon rare earth elements (REEs). The selected organic and inorganic sorbent materials demonstrated h...
Authors
Addleman, S. et al Pacific Northwest National Laboratory
geothermalsorbentsnanorare earth elementsreesprecious metalsmineral recoverygreen mininginorganic sorbent removal efficiencyorganic sorbent removal efficiencycomposite thin filmtechnoeconomicslanthanumeuropiumholmiumsilvercopperzinc

Utah FORGE: Phase-Picking Based Microseismic Event Catalog April 2024 Stimulation

Feb 19, 2026
1.73 MB
Publicly accessible
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a phase-picking workflow that integrates downhole geophones (wells 56 and 78B) and downhole DAS (well 16B). P and S-wave arr...
Authors
Zhu, W. et al University Of Utah
geothermalenergyapril 2024 stimulationforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationhydraulic fracturinggeomechanicsgeophysics

Fault Information and Seismicity for the Portland Basin Deep Direct-Use Feasibility Study

Dec 04, 2018
62.49 MB
Publicly accessible
Included in this dataset is a spreadsheet with the primary fault information used in the basin model, a spreadsheet with earthquake magnitude estimates, and a figure showing location of faults and microseismicity in the Portland Basin
Authors
Streig, A. and Wells, R. Portland State University
geothermalenergyddudeep direct-usethermal energy storageddu-tesseismicityearthquakefaultstructural geologymagnitudeeventmicroseismicityportlandbasinoregonormodelfeasibilityoatfield faulteast bank faultgales creek faultmount angel faultnewberg faultfrontal faultbolton faultcanby-molalla faulthelvetia faultbeaverton faultsherwood faultdip directiondip anglefault length

Brady's Geothermal Field DAS and DTS Surface and Borehole Array Metadata

Mar 31, 2016
3.71 MB
Publicly accessible
This metadata submission includes the coordinates of the DAS and DTS surface and borehole arrays, the list of file names, and the list of recorded files during testing at the PoroTomo Natural Laboratory at Brady Hot Spring in Nevada. Testing was completed during March 2016.
Authors
Fratta, D. University of Wisconsin
geothermaldasdtsfiber opticseismic arraytemperature arrayssurface sensorsborehole sensorscoordinatesfile listingfile listdata collection gapsdas datahorizontal arraymetadatautm coordinatesmetersborehole arrayboreholedistributed temperature sensingdistributed acoustic sensingseismic monitoringpassive monitoringgeophysics

Geothermal Permitting and NEPA Timeline Analysis

Sep 30, 2014
4.91 MB
Publicly accessible
In this analysis, we outline the types of NEPA-related analyses and approvals (e.g., environmental assessment), and we provide examples of geothermal development activities (e.g., well drilling) that might require each type of approval, including an overview and discussion of the ...
Authors
Young, K. et al National Renewable Energy Laboratory
geothermalenergynepanational environmental policy actpermittingpermittimelinenepa databasececxcategorical exclusiondetermination of nepa adequacydnaenvironmental assessmenteaenviromental impact statementeisopeneispecies

United States Geothermal Heat Pump Installations Database 2025

Sep 29, 2023
7.08 MB
Publicly accessible
This dataset documents U.S. geothermal heat pump (GHP) installations and was compiled as part of the 2025 Geothermal Market Report from the National Renewable Energy Laboratory (NREL). Records were sourced primarily from public drilling permits and include location information (ci...
Authors
Pauling, H. et al National Laboratory of the Rockies
geothermalheat pumpsghpinstallation databaseunited statesmarket report2025geothermal heat pumpground source heat pumpboreholedrilling permitsheating and coolingbuilding systemsprocessed datadatabaseborehole depthsystem capacitysystem configurationnumber of boreholes
<< Previous12345678Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service