OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 11 of 11.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Beaver County"×
Image×

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

USU Camas-1 Test Well: Documentation

Oct 31, 2018
77.61 MB
Publicly accessible
This submission contains documents that describe the USU Camas-1 test well, drilled in Camas Prairie, Idaho, in Fall 2018 and Fall 2019. The purpose of this well is to validate exploration methodologies of the Snake River Plain (SRP) Play Fairway Analysis (PFA) project.
Authors
Shervais, J. Utah State University
geothermalenergyidahocamas prairieusuutah state universitycamas-1test welldrillingwell datasnake river plainsrpblindresourcecharacterizationplay fairway analysispfaidaho department of water resourcesprospectuspermitlithologicgeophysicalgeophysicsconductivityresistivitytemperaturerhyolitegraniteclay-richgougelithologywellboreenvironmentenvironmentalimpactassessmenteawildlifewildlife inventorycultural inventoryseismiccore

End Use Load Profile (EULP) of US Building Sector resulting from mass GHP retrofits

Apr 15, 2023
239.96 MB
Curated
This collection of datasets describes the change (difference) in hourly energy consumption of the U.S. residential and commercial building stock while replacing existing HVAC systems with ground source heat pumps for all the balancing areas in the US, for all buildings eligible fo...
Authors
Liu, X. et al Oak Ridge National Laboratory
geothermalenergyeulpbuildingresidentialcommercialnationwideheat pumpghpend use load profiletechnicalassessmentlong-termprocessed data

SSGF Trace Element Concentrations

Jan 08, 2026
706.57 kB
Curated
Presented are trace element concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is actively being studied as a source of geothermal brine for lithium extraction. ...
Authors
Kovalick, A. et al University of California Riverside
geothermaltrace elementssalton sea geothermal fieldrocksmineralhydrothermallithium valleygeothermal brineraw dataimperial countyssgfimperial valleyrare earth elementsreecritical mineralsmnznconibrine-rock reactionrock samplesbrine samplesrhyolitic domesdurmid hillsschmitt and hulenca 2-14wellschemistryfluid chemistrygeochemistrysalton sealithium extraction

SSGF Mineral Major Elements and Lithium Concentration

May 01, 2023
1.38 MB
Awaiting release
Presented are major element and lithium concentrations of minerals from the Salton Sea Geothermal Field (SSGF), located in the Imperial Valley, California. With a recent increase in demand for lithium, the area is now being studied as a source of geothermal brine for lithium extr...
Authors
Humphreys, J. et al Lawrence Berkeley National Laboratory
geothermallithiummineralrockssalton sea geothermal fieldbrinelithium isotopteschloritegeologygeochemistryhydrothermalisotope quantificationextractionsalton sealithium valleygeothermal brineimperial countyraw data

Lightning Dock Geothermal Field GIS Data: Temperature

Aug 19, 2026
17.75 MB
In curation
Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico is a liquid-dominated system produced for binary (ORC) power generation. This submission includes the temperature GIS data for the project and a QGIS file which loads the files. For the ...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgistemperature

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Curated
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

Lightning Dock Geothermal Field GIS Data: Geological

Aug 19, 2026
79.52 MB
In curation
Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico is a liquid-dominated system produced for binary (ORC) power generation. This submission includes the geologic map and geologic GIS data for the project and a QGIS file which loads the f...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgisgeology

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service