Search GDR Data

Showing results 1 - 5 of 5.
Show results per page.
Order by:
Available Now:
Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"digital aerial photography"×
Image×

GOOML Kahunanui Data Curation, Historical Modeling, Forecast Modeling, and Genetic Optimization Examples

Jan 30, 2023
725.34 MB
Awaiting release
This dataset contains example files and Jupyter Notebooks associated with the Geothermal Operational Optimization using Machine Learning (GOOML) framework, specifically for the fictional Kahunanui (KHN) geothermal power plant. The dataset includes synthetic time series data, confi...
Authors
Taverna, N. et al Upflow
geothermalenergymachine learninggoomlpower plantoptimizationgenetic optimizationregressionneural networkoperationssynthetic datakahunanuiforecasthindcastdata curationinputsoutputsconfigurationexamplephygnnphysics guided neural networkssteamfieldsteam fieldwellsflash plantsprocessed datapythonjupyter notebookmodelmodelingcode

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

EGS Collab Experiment 2: Continuous Broadband Seismic Waveform Data

Sep 12, 2022
17.77 MB
Publicly accessible
The EGS Collab Experiment took place at the Sanford Underground Research Facility at the Homestake gold mine in Lead, SD, USA. This dataset includes the NSF SAGE website where seismic waveform data from this experiment can be downloaded. Two broadband seismometers were installed...
Authors
Rodriguez Tribaldos, V. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegswaveformsbroadbandtiltcharacterizationseismicwaveformgeophysicsexperiment 2continuousmonitoring4100 level