OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 21 of 21.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"geologic unit"×
Image×

Geothermal Data Gap Analysis Over the Western US

Oct 01, 2020
12.79 MB
Publicly accessible
NREL, as part of the Play Fairway Analysis Retrospective, compiled and mapped publicly available geologic and geophysical data in relation to the 2008 USGS geothermal potential analysis. Included in this submission are maps displaying the publicly available data for LIDAR coverage...
Authors
Rhodes, G. and Roberts, B. National Renewable Energy Laboratory
geothermalenergydata gap analysisgeologic mappinggeophysicspfaplay fairway analysisusgsaeromagneticgravity stationgeologygeologicmapcoveragelidardata gap

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Bradys Hot Springs Geothermal Area Build FEM Configuration

Jul 01, 2015
32.27 MB
Publicly accessible
This submission contains mesh information, nodal coordinates, connectivity data, and list of query points for the build FEM configuration.
Authors
Ali, T. University of Wisconsin
geothermalfemmeshnodal coordinatesrotated coordinatesconfigurationconnectivitygeologic database

Utah FORGE: Targeting Geothermal Resources with Geodetic Strain Data Paper

Oct 01, 2004
Size unavailable
Publicly accessible
The paper linked below offers an initial assessment of a new method to target potential geothermal resources on the regional scale. The method is based on seeking relationships between geologic structures and geodetic observations of regional tectonic strain.
Authors
Blewitt, G. et al Energy and Geoscience Institute at the University of Utah
geothermalforgeutah forgestraingreat basin strainegsgeodetictensorsecond invariantgeodesynevadautahratecrustalgpsfaultorientationmagnitude

Play Fairway Analysis CA-NV-OR: Figures on 2km Grids

Sep 15, 2015
98.44 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeologic profilegeochemistrygeophysicsstructuralquantity of dataseismicheat rankpermeabilityfavorabilityskewheat flowland accessprotected landcalifornianevadaoregonca-nv-orpfaplay fairway analysisrankheatseismic momentexplorationcharacterizationgeospatial datarastergeoreferenced

Conductance Steamflow Relationship at Darajat Geothermal Field

Apr 01, 2015
176.45 kB
Publicly accessible
These histograms represent our calibration of conductance of a volcanic geothermal field (with a clay cap) and the observed steam flow rates. Darajat is a vapor geothermal field located in West Java, Indonesia. First production from the field was started in 1994 and additional cap...
Authors
Trainor-Guitton, W. Lawrence Livermore National Laboratory
geothermalconductancesteam flowprobabilistichistogramdarajatindonesiawest javavapor dominatedvolcanicelectrical conductanceprobability

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Play Fairway Analysis CA-NV-OR: Additional 2km Grid Figures

Aug 05, 2015
21.36 MB
Publicly accessible
Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area. Grids at 2km, updated from 5km.
Authors
Ferguson, C. University of California
geothermaldegree of explorationheat flowdata differencemedicine lakesan emidiopermeabilitypfageologic profilerasterjpeggeoreferencedgeospatial dataheatrankca-nv-orplay fairway analysischaracterizationexplorationcalifornianevadaoregon

Community Geothermal: Soil Conductivity, Borehole Design, Energy Models, and Load Data for a Residential System Development Hinesburg, VT

Aug 30, 2024
743.47 MB
Publicly accessible
This dataset contains materials from the Coalition for Community-Supported Affordable Geothermal Energy Systems (C2SAGES) project, which evaluated the techno-economic feasibility of a community geothermal system for a residential development in Hinesburg, VT. The dataset includes ...
Authors
Jogineedi, R. et al GTI Energy
geothermalenergycommunity geothermalgeothermal sizingborehole testinggeothermal heat pumpworkforce developmentbuilding energy modelingground heat exchangergeothermal network designcommunity engagementcommgeohinesburgvermontmodelicaenergyplusonepipepythonmodelingthermal conductivity testreportenergy modelborehole designhourly energy loadssizinggeothermal loop sizingsystem designdevelopment

Improvements in 2016 to Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Aug 18, 2016
128.01 MB
Publicly accessible
*These files add to and replace same-named files found within Submission 559 (hover over file display names to see actual file names in bottom-left corner of screen)* The files included in this submission contain all data pertinent to the methods and results of a cohesive multi-st...
Authors
Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexreservoir flow capacityrpi rfcgpfa-abpfageothermal play fairway analysisexplanationmetadatafile descriptionmethodsreservoirssensitivity analysismonte carloshapefilegisgeospatial datanypawvcounty boundariescsvnortheastern united stateslow temperature

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Supercritical Drilling Materials Analysis: Drilling and Completion Materials Database

Sep 18, 2025
457.8 kB
Publicly accessible
This dataset compiles information on geothermal wells drilled into supercritical and near-supercritical conditions, with a focus on drilling and completion materials, fluid chemistry, and laboratory validation studies. The data are drawn from well reports, scientific literature, a...
Authors
Kibikas, W. et al Sandia National Laboratories
geothermalenergysupercritical geothermaldrilling materialscompletion materialsgeothermal wellsdrill bitscasingdrill stringslinerscementdrilling fluidslost circulation materialslcmfluid chemistrymaterial performanceliterature reviewcasing connections

Snake River Plain FORGE: Well Data for USGS-142

Nov 23, 2015
19.78 MB
Publicly accessible
Well data for the USGS-142 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, and photos of rhyolite core samples. This collection of data has been assembled as part of the site characterization data used to develop ...
Authors
Twining, B. Idaho National Laboratory
geothermalforgeegscore sample photosrhyolitelithologysrgcsnake river plainidahotempaddendumboreholelogusgs 142core samplesphotospresentationxrf datawhole rocktrace-element analysisignimibritethin sectionpetrographicimagesnatural gammagamma radiationtemperature profileneutron porositygamma-gammadensitywell logsrpcore samplecore photosmineralogypetrographygeologystratigraphic columnstratigraphyxrfsrg

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

Snake River Plain FORGE: Well Data for WO-2

Jul 29, 1991
67.2 MB
Publicly accessible
Well data for the WO-2 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, and rock strength parameters for the WO-2 well. This collection of data has been ass...
Authors
Podgorney, R. Idaho National Laboratory
geothermalforgeegssrgclithologywell logtemperature dataneotrondensitygammabasaltineelidahosnake river plainwo-2well dataneutronngrlograw datacore samplephotographrock strengthvertical stresscohesionfriction angletemperaturedepthchartanalysisdatareportsrpcaliperhole diameteraquiferrhonatural gamma radiationrecord of drillholeweatheringstrengthpoint load indexdrill logdrilling recordsdownholelithology reportsrgwell

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

EGS Collab Experiment 1: Earth Model Input Files

Dec 19, 2019
411.62 MB
Publicly accessible
The EGS Collab is conducting experiments in hydraulic fracturing at a depth of 1.5 km in the Sanford Underground Research Facility (SURF) on the 4850 Level. A total of eight ~60m-long subhorizontal boreholes were drilled at that depth on the western rib of the West Access Drift. S...
Authors
Neupane, G. and Sigma-V, T. Idaho National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsexperimentalhydraulic fracturingsubhorizontal boreholeswest access driftgeophysical monitoringjack leg boreholesgeophonestestbed 1earth modelinputmodellingautocadgeologysensorswell databoreholehomestake minegeospatial data

Natural Reservoir Analysis in Low-Temperature Geothermal Play Fairway Analysis for the Appalachian Basin

Oct 22, 2015
12.19 MB
Publicly accessible
The files included in this submission contain all data pertinent to the methods and results of this task's output, which is a cohesive multi-state map of all known potential geothermal reservoirs in our region, ranked by their potential favorability. Favorability is quantified usi...
Authors
Jordan, T. and Camp, E. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginiadistrict heatingdeep direct uselow-temperaturereservoirproductivityfavorabilityreservoir productivity indexrpigpfa-abgeothermal play fairway analysispfashapefilegisreservoirsgeospatial datacharacterizationarcgisqgisindexplay fairway analysislow temperature

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

DEEPEN: Final 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jan 24, 2024
1.3 GB
Publicly accessible
Part of the DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments) project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). This was tested...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsegsnewberrymagmatichydrothermalpfamodelingmodellingexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponentvolcanogeodata modelprocessed datageophysicscharacterization

DEEPEN 3D PFA Favorability Models and 2D Favorability Maps at Newberry Volcano

Jun 30, 2023
3.62 GB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. Part of the DEEPEN project involved developing and testing a methodology for a 3D play fairway analysis (PFA) for multiple play types (conventional hydrothermal, superhot EGS, and supercritical...
Authors
Taverna, N. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfamodellingmodelingcharacterizationexploration3d2dfavorabilityomfleapfrogmodelgeodatauncertaintycomponent
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service