OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 126 - 150 of 165.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"oil and gas"×
Other×

Hawaii Play Fairway Analysis: Mapped Faults

Jan 01, 2015
3.99 MB
Publicly accessible
Faults combined from USGS 2007 Geologic Map of the State of Hawaii and the USGS Quaternary Fault and Fold database. This data is in shapefile format.
Authors
Lautze, N. University of Hawaii
geothermalfaultshawaiigeologystructuralshapefileshape filearcgisgisgeospatial datapfa

Hawaii Play Fairway Analysis: Mapped Rifts

Jan 01, 2015
163.21 kB
Publicly accessible
Rifts mapped through reviewing the location of dikes and vents on the USGS 2007 Geologic Map of the State of Hawaii, as well as our assessment of topography, and, to a small extent, gravity data. Data is in shapefile format.
Authors
Lautze, N. University of Hawaii
geothermalriftshawaiigeologystructuralshapefileshape filearcgisgisgeospatial datapfa

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption

Sample Data from a Distributed Acoustic Sensing Experiment at Garner Valley, California

Sep 10, 2013
133.84 MB
Publicly accessible
In September 2013, an experiment using Distributed Acoustic Sensing (DAS) was conducted at Garner Valley, a test site of the University of California Santa Barbara (Lancelle et al., 2014). This submission includes one 45 kN shear shaker (called "large shaker" on the basemap) test ...
Authors
Lancelle, C. University of Wisconsin
geothermalporotomodasmapaccelerometergeophonegarner valleycaliforniadistributed acoustic sensingfiber-opticfiber opticsvibroseisposterproject summary

Project HOTSPOT: Kimberly Well Borehole Geophysics Database

Jul 04, 2011
973.96 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotsnake river plainyellowstone hotspotidahoborehole geophysicskimberlytemperaturepressuregamma rayseismicsonicmagnetic susceptibilityborehole logdownholegeophysicsgeochemistrythoriumuraniumneutronresistivitypotassiumimage logdownhole geophysicssrpboreholewell data

Nanofiltration Results: Membrane Removal of Calcium, Magnesium, Sodium, Silica, Lithium, Chlorine, and Sulfate from Simulated Geothermal Brines

Feb 06, 2016
35.91 kB
Publicly accessible
Results from a nanofiltration study utilizing simulated geothermal brines. The data includes a PDF documenting the process used to remove Calcium, Magnesium, Sodium, Silica, Lithium, Chlorine, and Sulfate from simulated geothermal brines. Three different membranes were evaluated...
Authors
Renew, J. Southern Research Institute
membrane nanofiltrationcalcium removalmagnesium removalsodium removalsilica removallithium removalchlorine removalsulfate removalmineral recoverynanofiltrationsimluated geothermal brinesilicachlorinesulfatelithiumsodiumcalciummagnesium

EGS Collab Experiment 1: Temperature profile

Apr 01, 2019
18.7 MB
Publicly accessible
This submission includes an input file, plot file, Fortran conversion file, and 3D data file from the simulation of the temperature profile within the Test Bed #1 of the EGS Collab project. The simulation was executed with PNNL's STOMP-GT simulator, which reads the input file, and...
Authors
White, M. Pacific Northwest National Laboratory
geothermalenergysurfegs collabnumerical simulationstomp-gtdataegstemperaturedistribution3dwest access driftfortrancodesanford underground research facility

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Brady Geothermal 1D Seismic Velocity Model

Feb 17, 2015
90.17 kB
Publicly accessible
This submission contains an ASCII text file of seismic velocities derived from ambient noise cross-correlation used to create a model of seismic velocity as a 1-D function of depth in addition to a quarterly report describing the creation and use of the model. Model uses 28 Green'...
Authors
Matzel, E. Lawrence Livermore National Laboratory
geothermalseismic velocity modelinsarambient noisebrady geothermal seismic modelseismicseismic velocity1d

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

New Mexico Play Fairway Analysis: Particle Tracking ArcGIS Map Packages

Nov 15, 2015
338.97 MB
Publicly accessible
These are map packages used to visualize geochemical particle-tracking analysis results in ArcGIS. It includes individual map packages for several regions of New Mexico including: Acoma, Rincon, Gila, Las Cruces, Socorro and Truth or Consequences.
Authors
Pepin, J. New Mexico Institute of Mining and Technology
geothermalparticle trackinggeochemistryboronlithiumnew mexicoacomagilarinconlas crucessocorrotruth or consequencest or cmap packagearcgisgisgeospatial datampknmpfaflow modelingheat flowadvectiveestimation

Raw Pressure Data from Observation Wells at Brady's Hot Springs

Mar 13, 2016
5.15 MB
Publicly accessible
This .csv files contain the raw water pressure data from three observation wells during pumping tests performed in the Spring of 2016. Included is a "read me" file explaining the details of where and how the data were collected.
Authors
Lim, D. University of Wisconsin
geothermalpressure sensorpressurebrady hot springsobservation wellspumping testspressure datawater pressureread me fileobservation wellporotomobradys geothermal area

Using Fully Coupled Hydro-Geomechanical Numerical Test Bed to Study Reservoir Stimulation with Low Hydraulic Pressure

Jan 31, 2012
6.63 MB
Publicly accessible
This paper documents our effort to use a fully coupled hydro-geomechanical numerical test bed to study using low hydraulic pressure to stimulate geothermal reservoirs with existing fracture network. In this low pressure stimulation strategy, fluid pressure is lower than the minimu...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalreservoir modelinghydraulic shearinghydraulic fracturingfracturereservoir stimulationlow pressurestimulation

Glass Buttes Well 52-33 Core Log

Oct 26, 2014
2.6 MB
Publicly accessible
Core log from Glass Buttes Well 52-33, drilled by Geodrill Rig 6 in 2014 to a depth of 3000 feet. Logged at 500 ft intervals.
Authors
Akerley, J. Ormat Nevada Inc
geothermalcore logoregonglass butteswell datalake countywell logdrill loglithologyfracturestemperatureminerologyminerals

West Flank Coso FORGE: 33A-7 Image and Mud Log Data

Apr 08, 2010
430.14 MB
Publicly accessible
Circumferential Borehole Imaging Log (CBIL) image log as DLIS file, and PDF mud log of well 33A-7 as part of the West Flank Coso, CA FORGE site.
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flank cosowell datacosomud logwell logformation logcircumferential borehole imaging logwest flankcalifornia

Raw Neutron Scattering Data for Strain Measurement of Hydraulically Loaded Granite and Marble Samples in Triaxial Stress State

May 23, 2014
22.11 MB
Publicly accessible
This entry contains raw data files from experiments performed on the Vulcan beamline at the Spallation Neutron Source at Oak Ridge National Laboratory using a pressure cell. Cylindrical granite and marble samples were subjected to confining pressures of either 0 psi or approximate...
Authors
Polsky, Y. Oak Ridge National Laboratory
geothermalneutronstrainhydraulic fracturingegsdiffractiongranitemarbletriaxialhydraulic fracturestressneutron scatteringvulcan beamline

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Play Fairway Analysis CA-NV-OR: Medicine Lake 2km MT

Aug 05, 2015
6.14 kB
Publicly accessible
Magnetotelluric (MT) data for Medicine lake with 2km grid.
Authors
M, C. University of California
geothermalmagnetotelluricmedicine lakemtpfaresistivityconductivitycaliforniacaca-nv-orplay fairway analysisexplorationcharacterizationgeophysics

Bradys Hot Springs Geothermal Area Build FEM Configuration

Jul 01, 2015
32.27 MB
Publicly accessible
This submission contains mesh information, nodal coordinates, connectivity data, and list of query points for the build FEM configuration.
Authors
Ali, T. University of Wisconsin
geothermalfemmeshnodal coordinatesrotated coordinatesconfigurationconnectivitygeologic database

Utah FORGE: Core Material Friction Experiments

Mar 15, 2023
696.08 MB
Publicly accessible
The following folders contain 3 friction experiments on Utah FORGE core material from depths of 6735 8533ft. The experiment conditions range from 100% relative humidity at room temperature to fluid-saturated at 110C. Experiments were done on both intact samples in a single-direct ...
Authors
Marone, C. et al Pennsylvania State University
utah forgegeothermalenergyfriction experimentsintact samplesgouge sampleshigh temperaturepore fluid pressuredrained boundary conditionspermeabilityvelocity stepshealingraw dataprocessed data

Triggered MEQ Events on LBNL Permanent Seismic Array, Brady's EGS, March 2016

Jun 01, 2016
83.98 kB
Publicly accessible
List of triggered events recorded on LBNL's permanent EGS seismic array at Brady's geothermal field. This submission also includes links to the NCEDC EGS Earthquake Catalog Search page and to the metadata for the seismic array installed at Brady's Geothermal Field.
Authors
Robertson, M. University of Wisconsin
geothermalporotomoegsseismic monitoringseismic networkseismicitymicroseismicityinduced seismicitymeqbradybradys geothermal fieldbradys hot springsearthquake catalogearthquakestimulationgeophysicsgeophysicalseismic

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

Brady's Geothermal Field Nodal Seismometers Metadata

Mar 28, 2016
279.97 MB
Publicly accessible
Metadata for the nodal seismometer array deployed at the POROTOMO's Natural Laboratory in Brady Hot Spring, Nevada during the March 2016 testing. Metadata includes location and timing for each instrument as well as file lists of data to be uploaded in a separate submission.
Authors
Parker, L. University of Wisconsin
geothermalbrady hot springsnevadametadatanodalseismometersporotomobradys geothermal areaseismicarraymonitoringseismicitygeophysics

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing
<< Previous1234567Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service