OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 95.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"distributed temperature survey"×
Other×

Cape EGS: Seismic Attenuation Profile and DAS Microseismic P-wave Spectra

Mar 17, 2026
15.25 GB
Publicly accessible
This dataset contains a 1D P-wave attenuation (Q) profile, distributed acoustic sensing (DAS) microseismic P-wave spectra, and derived source parameters from the Delano 1OB well at the Cape Modern geothermal field. The data were collected during a stimulation period from mid-Febru...
Authors
Chang, H. et al Lamont Doherty Earth Observatory
geothermalenergydasfiber-opticattenuationmicroseismicityp-wavesource parametersstress dropcapeforgeqspectraseismicegscape modernutah forgedistributed acoustic sensingp-wave attenuationquality factorbrune modelcorner frequencyseismic momentmoment magnitudewell logsdownhole measurementsraw dataprocessed datageomechanicsgeophysics

Summary of Geothermal Resources in the United States: GEOTHERM Data Set 1983

Apr 29, 1983
5.88 MB
Publicly accessible
The principal task of GEOTHERM is to provide information and research support for the conduct of national geothermal-resource assessments. The principal users of GEOTHERM are those involved with the Geothermal Research Program of the U.S. Geological Survey. These data include a pa...
Authors
Bliss, J. and Rapport, A. United States Geological Survey
geothermdatabasesoftwaregeothermal systemsusgsgeothermal wellswell characteristicshydrologygeochemistrydatabasesgeothermal fluidsreportscannedjournal articlecomputers and geosciencesgeospatial datapotentialgeothermal potentialgeology

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Hot Pot: Complete Bouguer Gravity Map

Jun 28, 2013
88.7 kB
Publicly accessible
Contoured Bouguer gravity survey with lease block outline in 2010 and location of hot springs.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeophysicsgravity surveymetadatabouger anomalygravity mapmap packagegisgeospatial data

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

West Flank Coso FORGE: Magnetotelluric 3D Data

Jan 01, 2016
10.66 MB
Publicly accessible
This is the 3D version of the MT data for the West Flank Coso FORGE area. The Coso geothermal field has had three Magnetotelluric (MT) datasets collected including surveys in 2003, 2006, and 2011. The final collection, in 2011, expanded the survey to the west and covers the West F...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegswest flankforgecaliforniamtgeophysicsinversionmagnetotelluricssurveycoso

Utah FORGE: Seismic DAS and Geophone Borehole Data Processing and 3D Imaging of Vp/Vs Ratio in the 2024 Stimulated Reservoir

Mar 17, 2025
1.28 MB
Publicly accessible
This dataset includes a final report and a 3D velocity model derived from seismic DAS and geophone borehole data collected during the April 2024 stimulation of the reservoir at Utah FORGE. The report details the processing of over 50,000 P and S-wave travel times used in a tomogra...
Authors
Gritto, R. and Jarpe, S. EMR Solutions and Technology
geothermalenergyutah forgeegsseismic borehole datadistributed acoustic sensingdasgeophone3d tomographytomographyp-wave velocitys-wave velocityvp/vs ratiovp/vsreservoir stimulationinduced seismicitywadati analysistravel-time inversioninversionfracturing fluids16a16bearthquake clustersubsurface imaginggeophysics

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Brady's Geothermal Field DAS Earthquake Data

Mar 21, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the vibration caused by a 3.4 M earthquake and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. Data is available in the original .sgy formats, as well as in standardized .h5 formats. Earthquake information : M ...
Authors
Feigl, K. University of Wisconsin
geothermalbrady hot springsporotomoseismicdistributed acoustic sensingearthquakedashorizontalverticalgeophysicsmonitoringseismicityarraypassive sourcenveqinduced seismicityseg-yhdf5

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

EGS Collab Experiment 2: Laser Scanned 4100 L Drift Map

Dec 19, 2019
1.26 GB
Publicly accessible
The EGS Collab project is evaluating a site for Experiment 2 (hydraulic fracturing/shearing) at a depth of 1.25 km in the Sanford Underground Research Facility (SURF) on the 4100 Level. Two early test holes were drilled in an alcove (formerly known as Battery Charging Station) nea...
Authors
Neupane, G. et al Idaho National Laboratory
geothermalenergylaser scanned drift mapsurfegs collabhydraulic shearingsanford underground research facilityhydraulic fracturingegslaser scanneddrift mapyates shaftbattery charging stationlaser surveytestbed 2experiment 2autocadleapfrogpoint cloudmapremote sensing

Brady's Geothermal Field DAS Vibroseis Data

Mar 25, 2016
4.08 GB
Publicly accessible
The submitted data correspond to the monitored vibrations caused by a vibroseis seismically exciting the ground in the vertical direction and captured by the DAS horizontal and vertical arrays during the PoroTomo Experiment. The data also include a file with the acceleration recor...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisdistributed acoustic sensingdasvertical dashorizontal dasaccelerometer responsegeophysicsactive sourceseismictruckgeophysicalnvsweepsegyseg-yh5hdf5

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations

Jan 01, 2012
34.45 MB
Publicly accessible
Active Management of Integrated Geothermal-CO2 Storage Reservoirs in Sedimentary Formations: An Approach to Improve Energy Recovery and Mitigate Risk: FY1 Final Report The purpose of phase 1 is to determine the feasibility of integrating geologic CO2 storage (GCS) with geothermal ...
Authors
A., T. Lawrence Livermore National Laboratory
geothermalgeologic co2 storagepressure managementpressure supportworking fluidheat extractionco2 cutsedimentary

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Utah FORGE: Development of a Reservoir Seismic Velocity Model and Seismic Resolution Study

Apr 30, 2022
15.3 MB
Publicly accessible
This is data from and a final report on the development of a 3D velocity model for the larger FORGE area and on the seismic resolution in the stimulated fracture volume at the bottom of well 16A-32. The velocity model was developed using RMS velocities of the seismic reflection su...
Authors
Vasco, D. and Chan, C. Array Information Technology
geothermalenergyseismic velocity modelseismic resolution3d p-wave3d s-waveseismicraw dataprocessed datawell 16a-32utah forge

EGS Collab Experiment 1: Temperature profile

Apr 01, 2019
18.7 MB
Publicly accessible
This submission includes an input file, plot file, Fortran conversion file, and 3D data file from the simulation of the temperature profile within the Test Bed #1 of the EGS Collab project. The simulation was executed with PNNL's STOMP-GT simulator, which reads the input file, and...
Authors
White, M. Pacific Northwest National Laboratory
geothermalenergysurfegs collabnumerical simulationstomp-gtdataegstemperaturedistribution3dwest access driftfortrancodesanford underground research facility

Hot Pot: Contoured Temperature Gradient Map

Jun 28, 2013
90.5 kB
Publicly accessible
Temperature gradient contours derived from Oski temperature gradient hole program and from earlier published information.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot pottemperature gradientmap packagemetadatagisgeospatial data

AASG Wells Data for the EGS Test Site Planning and Analysis Task

Oct 09, 2013
32.16 MB
Publicly accessible
Temperature measurement data obtained from boreholes for the Association of American State Geologists (AASG) geothermal data project. Typically bottomhole temperatures are recorded from log headers, and this information is provided through a borehole temperature observation servic...
Authors
Augustine, C. National Renewable Energy Laboratory
geothermalwelltemperatureegs test sitebottomholeshpboreholeborehole temperaturedataegsgeospatial data

Stanford Thermal Earth Model for the Conterminous United States

Mar 14, 2024
21.57 GB
Publicly accessible
Provided here are various forms of the Stanford Thermal Earth Model, as well as the data and methods used for its creation. The predictions produced by this model were visualized in two-dimensional spatial maps across the modeled depths (0-7 km) for the conterminous United States....
Authors
Aljubran, M. and Horne, R. Stanford University
thermal earth modeltemperaturegeothermalenergystanfordtemperature-at-depthheat flowrock thermal conductivityinterpignnphysics-informedgraph neural networksmachine learningmodeltemperature modelarcgisapimodel inputsmodel outputsdata-drivenspatial interpolationalgorithmheat conductionbottomhole temperature

Snake River Plain Geothermal Play Fairway Analysis Project MT Data

May 06, 2018
12.02 MB
Publicly accessible
MT is measured in the field by using induction coils to measure the time-varying magnetic source for frequencies between 1000-0.001~Hz, and electric dipoles to measure the Earth's electrical response. Because the magnetic source field is polarized, orthogonal directions of the f...
Authors
Peacock, J. et al United States Geological Survey
geothermalenergysnake river plainpfaplay fairway analysisidahocamasprairiemagnetotelluricsmtdataresistivityconductivityelectricalgeophysicsgeophysicalsrp

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation
<< Previous1234Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service