OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 124.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"energy model"×
Other×

Cape EGS: Seismic Attenuation Profile and DAS Microseismic P-wave Spectra

Mar 17, 2026
15.25 GB
Publicly accessible
This dataset contains a 1D P-wave attenuation (Q) profile, distributed acoustic sensing (DAS) microseismic P-wave spectra, and derived source parameters from the Delano 1OB well at the Cape Modern geothermal field. The data were collected during a stimulation period from mid-Febru...
Authors
Chang, H. et al Lamont Doherty Earth Observatory
geothermalenergydasfiber-opticattenuationmicroseismicityp-wavesource parametersstress dropcapeforgeqspectraseismicegscape modernutah forgedistributed acoustic sensingp-wave attenuationquality factorbrune modelcorner frequencyseismic momentmoment magnitudewell logsdownhole measurementsraw dataprocessed datageomechanicsgeophysics

Hot Pot: Maps of Project Area, Infrastructure, and Natural Features

Jun 27, 2013
751.34 kB
Publicly accessible
This dataset includes a map package containing locations of important geographic features around the Hot Pot Geothermal Project, near Winnemucca, Nevada. The package contains a relief base with maps for outlines of leases, major roads, railroads, rivers, and hot springs. Also incl...
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeologyhot springsmap filearc gis map packagegismap packageshapefilegeographic datainfrastructurerailroadshighwaysstructuresmapspaleozoic

3D Seismic Reflection Attributes of a Geothermal Area

Sep 15, 2014
2.51 MB
Publicly accessible
Images from a 3D seismic reflection survey across a geothermal area are shown. Images of coherency and acoustic impedance are shown. Well tracks and MEQ location are overlain.
Authors
J., R. Lawrence Livermore National Laboratory
geothermalattributes3d seismic reflectionattributeimagesimagingsubsurfacegeophysicsgeophysical surveyseismicmodelacousticsmeqmicroearthquakewell

Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation

Jan 01, 2010
780.83 kB
Publicly accessible
Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation, Walsh, et al, Ormat
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermal alterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidar3d geologic modelpeer reviewfield workhyperspectralgravitymineral assemblages

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

GIS Resource Compilation Map Package Applications of Machine Learning Techniques to Geothermal Play Fairway Analysis in the Great Basin Region, Nevada

Jun 01, 2021
831.16 MB
Publicly accessible
This submission contains an ESRI map package (.mpk) with an embedded geodatabase for GIS resources used or derived in the Nevada Machine Learning project, meant to accompany the final report. The package includes layer descriptions, layer grouping, and symbology. Layer groups incl...
Authors
Brown, S. et al Nevada Bureau of Mines and Geology
geothermalenergynevadamachine learningmap packagegispcanmfbnnannelmgeochemistrygeophysicsheat flowslip and dilationstructureplay fairwaypfaexplorationcharacterizationgreat basindlipdilationgeodatabasehydrothermaldatamodelsprocessed datapaleo-geothermal featurestest sittessupervisedunsupervisedcultural

Snake River Plain Geothermal Play Fairway Analysis Project MT Data

May 06, 2018
12.02 MB
Publicly accessible
MT is measured in the field by using induction coils to measure the time-varying magnetic source for frequencies between 1000-0.001~Hz, and electric dipoles to measure the Earth's electrical response. Because the magnetic source field is polarized, orthogonal directions of the f...
Authors
Peacock, J. et al United States Geological Survey
geothermalenergysnake river plainpfaplay fairway analysisidahocamasprairiemagnetotelluricsmtdataresistivityconductivityelectricalgeophysicsgeophysicalsrp

Geothermal Electricity Technology Evaluation Model (GETEM) Individual Case Files and Summary Spreadsheet (GETEM version Spring 2013)

Mar 07, 2013
54.02 MB
Publicly accessible
This group of files includes 10 GETEM individual scenario files and 1 summary spreadsheet. Each spreadsheet contains final data (following the revisions made between summer of 2011 and spring of 2013).
Authors
Entingh, D. et al Idaho National Laboratory
geothermalgetemgeothermal electricity technology evaluation modellevelized cost of electricitylcoe

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Simulations of Brady's-Type Fault Undergoing CO2 Push-Pull: Pressure-Transient and Sensitivity Analysis

Mar 09, 2018
9.74 MB
Publicly accessible
Input and output files used for fault characterization through numerical simulation using iTOUGH2. The synthetic data for the push period are generated by running a forward simulation (input parameters are provided in iTOUGH2 Brady GF6 Input Parameters.txt [InvExt6i.txt]). In gene...
Authors
Jung, Y. and Doughty, C. Lawrence Berkeley National Laboratory
geothermalenergyegsco2carbon dioxidepush-pullpressure-transient testingitough2sensitivity analysisinverse modelingparameter estimationinconpesttough2fault modelinggf6bradyfaultingfaultfracturecharacterizationstimulation

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

G-Function Library for Modeling Vertical Bore Ground Heat Exchanger

Jun 30, 2021
234.14 MB
Publicly accessible
This library contains g-functions (thermal response functions) for standard, regularly spaced vertical borehole ground heat exchangers. In total, it contains 34, 321 configurations. To permit interpolation, each configuration has g-functions for heights of 24, 48, 96, 192, and 384...
Authors
Spitler, J. et al Oak Ridge National Laboratory
geothermalenergyheat pumpground heat exchangerg-functionlibrarythermal response functionssimulationground heat pumpghpmodelheat exchanger

Dataset for report: Non-Technical Barriers to Geothermal Development in California and Nevada

Mar 10, 2022
66.68 MB
Publicly accessible
In California and Nevada, geothermal projects are subject to non-technical barriers, which may create development delays leading to higher project costs and risks and decreased competitiveness with other electricity generation technologies. These non-technical barriers may include...
Authors
Levine, A. et al National Renewable Energy Laboratory
geothermalenergycalifornianevadasalton searegulatorybarriersnon-technicalinterviewsenvironmentalstakeholdersnon-technical barriersntbgeoreportseatpermitenvironmental reviewauthorizationseconomiclcoecostfeasibilityprocessed dataannual technology baselineatbimperial countychurchill county

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. shp and tif files are zipped with all applicable sideca...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Cascades/Aleutian Play Fairway Analysis: Data and Map Files

Nov 15, 2015
1.44 GB
Publicly accessible
Contains Excel data files used to quantifiably rank the geothermal potential of each of the young volcanic centers of the Cascade and Aleutian Arcs using world power production volcanic centers as benchmarks. Also contains shapefiles used in play fairway analysis with power plant...
Authors
Shevenell, L. ATLAS Geosciences Inc
geothermalworld volcanic centersplay fairwaycascadesaleutianspfaplay fairway analysisgis datamap datamap packagegeochemistrygeothermometryspringswellsfumarolessurface areapower plantsmw capacitiessurface areasvolcanic ventsrock typevolcanic centersstructural characteristicstectonic settingshapefilesaleutiangeochemsitry datastructural datageospatial data

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Fine Scale Stress Test Modelling

Feb 22, 2021
132.27 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modelling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, fo...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcestress teststress modelingmodelstressinjectionwithdrawalfluidsimulationaquifer storage cooling systemreservoir cooling systemstockton universitynew jerseygeothermal coolingcfdflow simulationfea

Thermal-Hydrological-Mechanical Modelling of Stockton University Reservoir Cooling System, Large Scale Grid

Feb 26, 2021
248.07 MB
Publicly accessible
Mesh, properties, initial conditions, injection/withdrawal rates for modeling thermal, hydrological, and mechanical effects of fluid injection to and withdrawal from ground for Stockton University reservoir cooling system (aquifer storage cooling system), Galloway, New Jersey, on ...
Authors
Smith, J. et al Lawrence Berkeley National Laboratory
geothermalcoolingthermal-hydrological-mechanicalmodelingground sourcesimulationflowcfdflow simulationmodelreservoir coolinginjectionreservoir cooling systemaquifer storage cooling systemgroundground coolinggeothermal coolingreservoirnew jerseystockton universitywithdrawalfea

Evaluation Data of a High Temperature COTS (Commercial Off-the-Shelf) Flash Memory Module (TI SM28VLT32) for Use in Geothermal Electronics Packages

Aug 29, 2014
284.53 MB
Publicly accessible
The accompanying raw data is from tests of the TI SM28VLT32 flash memory module at temps of 200C, 225C, and 29C. Each data file is 3 columns and tab-delimited with the first column being the data address, the second column being the first byte of the data, and the third column bei...
Authors
Cashion, A. Sandia National Laboratories
geothermaldownhole electronicscomponent evaluationborehole temperaturesmemoryevaluation datahigh temperaturecots flash memory modelelectronicsflash memory moduleti sm28vlt32

An HPC-Based Hydrothermal Finite Element Simulator for Modeling Underground Geothermal Behavior with Example Simulations on The Treasure Island and UC Berkeley Campus

Aug 01, 2021
186.08 MB
Publicly accessible
This submission contains the source code of the Hydrothermal Finite Element Simulator used for the Treasure Island and UC Berkeley campus geothermal simulation. It contains a report that summarizes the development and validation of this Hydrothermal Finite Element Simulator, with ...
Authors
Chen, K. et al Lawrence Berkeley National Laboratory
geothermalenergyfinite elementcoupled hydrothermal modelingcommunity scaleground source heat pumpparallel computingdeal.iidistrict heating and cooling systemsubsurface heat responsetreasure islanduc berkeley campuscsimulationuc berkeleydistrict heatingdistrict coolingenergy deliverygeothermal storagegoethermal energy storageenergy storage

Transported Geothermal Energy Technoeconomic Screening Tool Calculation Engine

Sep 21, 2016
449.36 kB
Publicly accessible
This calculation engine estimates technoeconomic feasibility for transported geothermal energy projects. The TGE screening tool (geotool.exe) takes input from input file (input.txt), and list results into output file (output.txt). Both the input and ouput files are in the same f...
Authors
Liu, X. Oak Ridge National Laboratory
geothermaltranportedabsorptionlow temperaturetransported

Geothermal Life Cycle Calculator

Mar 11, 2014
95.09 kB
Publicly accessible
This calculator is a handy tool for interested parties to estimate two key life cycle metrics, fossil energy consumption (Etot) and greenhouse gas emission (ghgtot) ratios, for geothermal electric power production. It is based solely on data developed by Argonne National Laborator...
Authors
Sullivan, J. Argonne National Laboratory
geothermalcalculatorlife cycle metricsgreenhouse emissions ratelife cycle metricgreenhouse gas emissions ratefossil energy consumptiongreenhouse gas emissionsratioselectric powerlife cycleghgemissionsperformanceexplorationcapacitylifetimecapacity factorenvironmentenvironmentalratioenergy

GeoRePORT Protocol and Spreadsheet Template

Sep 30, 2019
12.26 MB
Publicly accessible
The Geothermal Resource Portfolio Optimization and Reporting Technique (GeoRePORT) was developed with funding from the U.S. Department of Energy Geothermal Technologies Office to assist in identifying and pursuing long-term investment strategies through the development of a resour...
Authors
Kolker, A. et al National Renewable Energy Laboratory
geothermalenergyapplicationsoftwaretoolresourceassessmentsocialtechnicaleconomicfeasibilityprotocolgeoreportsociotechnoreportinggradeexplorationinputproject readinessportfoliooptimizationworksheet

Design of an Airlift Bioreactor

Mar 13, 2017
417.07 kB
Publicly accessible
An important consideration for the process design is cell immobilization-enabled flow-through operation. Large-scale biosorption relies on cells that are immobilized on a supporting substrate and used to 'attract' metal ions. Cell immobilization allows easy separation of the feed...
Authors
Jiao, Y. et al Lawrence Livermore National Laboratory
geothermalenergybioreactorairliftrare earthbiosorptionadsorptionreebiofilmresource recoverybioadsorption
<< Previous12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service