OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 26 - 50 of 138.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Utah FORGE final report"×
Seismic×

Utah FORGE: Seismic Risk Trafic Light System Version 2

Jan 24, 2025
574.05 kB
Publicly accessible
The report outlines the updated Traffic Light System (TLS) for the Utah FORGE project, which aims to mitigate seismic risks associated with Enhanced Geothermal Systems (EGS) operations. It integrates lessons from past operations, including stimulation and circulation experiments a...
Authors
Pankow, K. et al University of Utah Seismograph Stations
geothermalenergyseismicseismic hazardstlstrafic light systemutah forgeseismic hazard mitigationwell stimulationegstraffic light systemseismic risk mitigationstimulationcirculationcape stationseismic thresholdsreal-time monitoringqseekreservoir dynamicsseismic eventsmagnitude thresholdsprotocols

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Utah FORGE: Phase-Picking Based Microseismic Event Catalog April 2024 Stimulation

Feb 19, 2026
1.73 MB
Publicly accessible
This catalog contains microseismic event locations recorded during the April 2024 stimulation at the Utah FORGE site. Events were detected and located using a phase-picking workflow that integrates downhole geophones (wells 56 and 78B) and downhole DAS (well 16B). P and S-wave arr...
Authors
Zhu, W. et al University Of Utah
geothermalenergyapril 2024 stimulationforgeutahmicroseismic event locationsutah forgeuniversity of utahseismicaimachine learningdata-driven decisionscommunity safteyinfrastructure protectionproactive risk mitigationimproved safteyimmediate responsestimulationfracingground motionseismic hazardsegsevent catalogmlprocessed datareservoir characterizationhydraulic fracturinggeomechanicsgeophysics

Utah FORGE: Microseismic Monitoring Geophone Data from Well 78-32

Mar 18, 2020
4.64 MB
Publicly accessible
This submission includes geophone data collected by Schlumberger from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. The data are hosted by the Center for High Performance Computing (CHPC) at the University of Utah, and a script for dow...
Authors
Pankow, K. University of Utah
geothermalenergyutah forgeforgeutahgeophone78-32raw datageophysicsmicroseismicitystimulationegsseismicmonitoringseismicitydrilling

Utah FORGE 5-2419: Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging 2025 Workshop Presentation

Sep 18, 2025
128.96 MB
Publicly accessible
This is a presentation on the Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging project by Pennsylvania State University, presented by Derek Elsworth. The project's objectives were to explore controls and acoustic signatures of aseismic through seismic ev...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegsseismicitypermeabilitynonlinear acoustic imagingfracture reactivationfriction stabilitystress statestimulationgeomechanics2025 annual workshoppresentationpresentation recordingpresentation slidesreport

Utah FORGE 3-2417: DAS Microseismic Event Catalog from the 16A/16B Circulation Test, 2023

Jun 12, 2024
2.41 MB
Publicly accessible
This preliminary data archive includes the relocated microseismic event catalog, 1D velocity model, and methods report from DAS acquisition conducted during the Well 16A and 16B circulation test (July 19th and 20th, 2023) at Utah FORGE. The methods report describes all processing ...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyforgeutah forgeegsenhanced geothermaldasdistributed acoustic sensingmicroseismicevent catalogevent detectionfogmoreinversiongeophysicsreal-time16a16bcirculation testconnectivitymethodsrelocationhierarchical clusteringprocessed data

Utah FORGE 5-2557: Fluid and Temperature in Fracture Mechanics and Coupled THMC Processes 2025 Workshop Presentation

Sep 18, 2025
106.89 MB
Publicly accessible
This is a presentation on the Role of Fluid and Temperature in Fracture Mechanics and Coupled Thermo-Hydro-Mechanical-Chemical (THMC) Processes for Enhanced Geothermal Systems project by Purdue University, presented by Distinguished Professor of Physics & Astronomy, Dr. Laura J. P...
Authors
Pyrak-Nolte, L. Purdue University
geothermalenergyutah forgeegs2025 annual workshopfracture mechanicsthmcfluid-rock interactionsrate-and-statefrictioncoulomb failureseismicaseismicgeomechanicspresentationpresentation recordingpresentation slidesreport

Utah FORGE: High-Resolution DAS Microseismic Data from Well 78-32

Oct 20, 2019
7.42 MB
Publicly accessible
This regards a high-resolution DAS microseismic dataset produced by Silixa from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. It is a very large dataset and as such it is currently not directly available on GDR. However, it is availabl...
Authors
Martin, T. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutah geothermalmicroseismic datasilixa microseismic datawell 78-32 microseismic datawell 58-32 stimulation seismicityforge phase 2csilixawell 58-32well 78-32utahmilfordroosevelt hot springssegyseg-ydasdistributed acoustic sensingdxsmicroseismicitydasvmonitoringwell locationwell datadtsdistributed temperature sensingprocessed datageophysicsstimulationraw data

Utah FORGE 3-2417: DAS Microseismic Event and MT Catalog from the 16A/16B Circulation Test [Final, Relocated], 2023

May 19, 2025
1.34 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog from distributed acoustic sensing (DAS) acquisition conducted during the 16A-16B circulation tests that took place in July 2023. These results update the catalog presented in GDR 1613 (the preliminary catalog, lin...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalevent catalog16a16bcirculationcirculation testinversionseismic eventsevent detectionmtdistributed acoustic sensingprocessed datamicroseismic event catalogmeqfogmore

Utah FORGE 6-3656: Real-Time Traffic Light System and Reservoir Engineering with Seismicity Forecasting and Ground Motion Prediction 2025 Workshop Presentation

Sep 18, 2025
86.94 MB
Publicly accessible
This is a presentation on Real-Time Robust Adaptive Traffic Light System and Reservoir Engineering with Machine-Learning-Based Seismicity Forecasting and Data-Driven Ground Motion Prediction (RT Forecast) by Lawrence Berkeley National Laboratory, presented by Nori Nakata. This vid...
Authors
Nakata, N. Lawrence Berkeley National Laboratory
geothermalenergyutah forge2025 annual workshopegsinduced seismicitytraffic light systemmachine learningseismicityforecastingground motion predictiongenerative aireservoir engineeringhigh-pressure experimentspresentationpresentation slidespresentation recordingreport

Utah FORGE: DAS Microseismic Event Records From April 2024 Stimulation Experiment

Mar 25, 2026
1.29 TB
In curation
This dataset contains distributed acoustic sensing (DAS) microseismic event triggers (raw waveforms) recorded during the 16A-16B stimulations conducted at the Utah FORGE site in April 2024. The dataset consists of raw waveform data provided in nanostrain rate units, accompanied by...
Authors
Ajo-Franklin, J. et al Rice University
geothermalenergyutah forgeenhanced geothermal systemsegsdistributed acoustic sensingdasfiber optic monitoringdfosmicroseismicforgewaveformraw datastimulationevent triggersfiber opticgeophysicsgeomechanicshydraulic stimulationhydraulic fracturingdas channel locationssgyseg-ysilixacarinafogmore

Utah FORGE 2439: Machine Learning for Well 16A(78)-32 Stress Predictions

Jun 19, 2023
2.3 MB
Publicly accessible
This report reviews the training of machine learning algorithms to laboratory triaxial ultrasonic velocity data for Utah FORGE Well 16A(78)-32. Three machine learning (ML) predictive models were developed for the prediction of vertical and two orthogonally oriented horizontal str...
Authors
Kelley, M. et al Battelle Memorial Institute
geothermalenergymachine learningin-situ stressstress characterizationutah forgegeophysicsseismictriaxialstress predictionartificial neural networkmodelfeed forward artificial neural network

Utah FORGE 6-3712: Report on a Data Foundation for Real-Time Identification of Microseismic Events

Jan 21, 2025
971.63 kB
Publicly accessible
This submission is a technical report for the Probabilistic Estimation of Seismic Response Using Physics Informed Recurrent Neural Networks project. The report describes the process of extracting events from the borehole seismic sensors. To be effective once deployed, the process ...
Authors
Williams, J. et al Global Technology Connection, Inc.
geothermalenergyutah forgedata processingmachine learninginduced seismicitytechnical reportevent detectionmlartificial intelligenceaireal-timephysics informedrecurrent neural networksborehole seismicseismic datamicroseismicevent catalogmagnitude-frequency distributiongeophysicsegs

Utah FORGE: 2023 Induced Seismicity Mitigation Plan

Aug 09, 2023
7.97 MB
Publicly accessible
This is the updated Utah FORGE Phase 3B induced seismicity mitigation plan (ISMP) covering the general Utah FORGE area. This new version incorporates newly collected seismic data, including data collected during the 2022 stimulation and a probabilistic seismic hazard assessment (...
Authors
Pankow, K. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic mitigation planseismic mitigationseismicityseismicseismic hazardsearthquakesinduced seismicitygeophysicsfaultsoutreachriskhazardegsseismic monitoringseismic hazard assesment

Utah FORGE 3-2417: DAS-derived Moment Tensors from the 16A/16B Stimulation April, 2024

Aug 22, 2025
1.41 MB
Publicly accessible
This dataset contains a catalog of moment tensors derived from distributed acoustic sensing (DAS) data acquired during stimulation of Utah FORGE Well 16A, conducted between April 3 and April 7, 2024. The data were generated as part of the FOGMORE (Fiber Optic MOnitoring for Reserv...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicmoment tensorenhanced geothermalegsfogmoresilixa16a stimulationdistributed acoustic sensingfiber opticsseismic monitoringstimulationmicroseismicitycarinaidasseismic inversiongeophysicssubsurface characterizationseismic momentconfidence indexcondition numbermoment catalogprocessed data

Utah FORGE: GES Well 16A(78)-32 and Well 16B(78)-32 Stimulation Seismic Event Catalogs

Apr 30, 2024
26.17 MB
Publicly accessible
This dataset contains seismic event catalogs from the hydraulic stimulation of wells 16A(78)-32 and 16B(78)-32 at the Utah FORGE site in April 2024. The data was collected by Geo Energy Suisse (GES) using a variety of seismic monitoring technologies, including 3-component (3C) geo...
Authors
Dyer, B. et al University of Utah Seismograph Stations
geothermalenergyseismic dataseismicgeo energy suissegeswell stimulationfracfracingstimulationwell 16a78-32well 16b78-32utah forgeseismic catalogmicroseismic16a16begsdistributed acoustic sensingdasprocessed datareal timedelano-13cgeophonehydraulic injection

Utah FORGE: Well 16A(78)-32 Hydraulic Fracturing Stage 8 Crosswell Strain FDI and Microseismic Presentations April 2024

Nov 07, 2024
96 MB
Publicly accessible
This is a pair of PowerPoint presentations from Neubrex Energy Services (US), LLC. The presentations review work done in April 2024 on crosswell strain fracture driven interactions (FDI) and microseismic event monitoring during hydraulic fracturing in stage 8 of Utah FORGE well 16...
Authors
Jurick, D. et al Neubrex Energy Services (US), LLC
geothermalenergywell 16a16acrosswell strainfdimicroseismicneubrexstrainstrain raterfs strain16bfar field strainfracture driven interactionsstage 8utah forgeegsprocessed datatechnical reportcrosswellhydraulic fracturingstimulation16a78-3216b78-32fiber optic sensingdistributed strain sensingdssgeophysics

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Publicly accessible
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics

Utah FORGE 3-2417: DAS Microseismic Event Catalog from April 2024 Stimulation

Jun 09, 2025
9.11 MB
Publicly accessible
This data archive includes the relocated microseismic event catalog and 3D velocity model from DAS acquisition conducted during the 16A stimulations that took place between April 3rd and April 7th, 2024. The catalog consists of multiple CSV files, each named after the associated s...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalfogmoreevent catalogcatalogmicroseismic eventsilixadistributed acoustic sensingidas16astimulationprocessed datavelocity modeldelano

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

Seismic Survey 2016 Metadata at San Emidio, Nevada

Dec 05, 2016
54.86 MB
Publicly accessible
1301 Vertical Component seismic instruments were deployed at San Emidio Geothermal field in Nevada in December 2016. The first record starts at 2016-12-05T02:00:00.000000Z (UTC) and the last record ends at 2016-12-11T14:00:59.998000Z (UTC). Data are stored in individual files in o...
Authors
Lord, N. et al University of Wisconsin
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalseismicseismicitydatametadatasurveynevadareporttechnical specificationintrumentationspecsspecspecifications

Washington Geothermal Play Fairway Analysis Heat, Permeability, and Fracture Model Data

Dec 07, 2017
283.19 MB
Publicly accessible
This submission contains raster and vector data for the entire state of Washington, with specific emphasis on the three geothermal play fairway sites: Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV), and Mount Baker (MB). Data are provided for 3 major geothermal mo...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay fairwaywashingtonmodelconfidencefavorabilityriskmtmagnetotelluricsseismicityseismicvelocityp-waves-wavegeothermometryintrusive rockspringstemperature gradientvolcanic ventsland useprocess watertransmissionurbanwatergroundwatergeophysicsfaultslipdilationtendancycoulomb shear stressslip gradientpoly3dpfashapefilesarcgisshape filegeospatial datamodelingmappingintegratedinverseinversionwashington state

Validation of Innovative Exploration Technologies for Newberry Volcano: Report of 4D Seismic Analysis

Dec 12, 2012
Size unavailable
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: Report of 4-D seismic Analysis by Apex HiPoint (Sigma3) 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
newberryvolcanooregoncalderaseismic4-dapex hipointsigma3iet4danalysis4d seismicexplorationhydrothermalegs

Utah FORGE: Seismograph Station Information and Data

Jan 26, 2021
Size unavailable
Publicly accessible
This link leads to the University of Utah Seismograph Stations website Utah FORGE seismograph stations page. This page contains a location map and description of the Utah FORGE seismograph stations and other related information. Additionally, data can be downloaded for each statio...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalforgeutah forgewell 68-32 seismic datautah forge seismograph stationsuniversity of utah seismograph stationsutah seismograph stationsuniversity of utahegsmilfordutahroosevelt hot springsseismographstationsseismicboreholewebicordergeophysics
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service