OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 140.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"Metadata"×

Nevada Play Fairway Steptoe Valley Geodatabase and Modeling Data

Aug 25, 2018
85.56 MB
Publicly accessible
This package contains data and metadata for the 3d thermal model, well lithology logs, gravity grids and depth to basement inversions, play fairway modelling, and ArcGIS geodatabase resources. This project focused on defining geothermal play fairways and development of a detailed...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergynevadaplay fairwaygravitythermal modelsteptoe valleynvgeophysicsmodelingprobe surveypfageodatabasegeospatial datagisarcgisshapefilethermalmodellithologylogsdepth to basementcross sectionwell loggridinversionnv great basin

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Brady's Geothermal Field DASH Resampled in Time

Jul 07, 2017
7.44 TB
Publicly accessible
This submission includes a link to the DASH (Horizontal distributed acoustic sensing) data files that were resampled in time to 100 samples per second from the original 1000 samples per second files. Data is in 30 second Matlab files organized into directories by day. The README_D...
Authors
Feigl, K. University of Wisconsin
geothermalporotomodasfiber opticdistributed acoustic sensingsurface sensorsseismic arraybrady hot springnevadaporoelastic tomographymatlabhorizontalgeophysicsdash

EGS Collab Experiment 2: Wireline Geophysical Well Logs

Jul 09, 2019
2.05 GB
Publicly accessible
This is the full wireline geophysical datasets for characterization of the EGS Collab Experiment #2 testbed. A metadata fill is included within the dataset explaining the logs, fracture picks, etc. Eleven boreholes were drilled for this testbed and each one was logged with north s...
Authors
Ulrich, C. and Schwering, P. Lawrence Berkeley National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsgeophysicswirelinewell dataprocessed dataraw dataexcelwellcadleadsouth dakota

Utah FORGE: InSAR Data Best Pairs

May 31, 2023
4.9 GB
Publicly accessible
This submission provides Interferometric Synthetic Aperture Radar (InSAR) data covering the Utah FORGE site via the TerraSAR-X and TanDEM-X satellite missions operated by the German Space Agency (DLR). Data was collected between 2019/01/01 and 2023/06/30. Interferometric pairs (...
Authors
Batzli, S. and Feigl, K. University of Wisconsin Madison
geothermalenergyutah forgeforgeutah geothermalreservoirengineeringhydraulicfracturingegsremote sensinginsargeospatial dataprocessed dataterrasar-xtandem-xdigital elevation modelrasterdlrgmt-sargeneric mapping tool

Newberry EGS Demonstration: Well 55-29 Stimulation Data

Dec 08, 2012
273.53 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
T., T. AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgengeophysical logsdiverter injectionseismicwell constructiondaily reporttracer injection and groundwater monitoringlithologytemperaturegeochemistrystimulation datapublicationswhpflowstimulationhydraulicwaterseismicitymonitoringmicroseismicitywelllogdrillingreportcataloggeophysicscasing55-29diverterstzim

Analyzed DTS Data, Guelph, ON Canada

Jul 01, 2015
4.73 MB
Publicly accessible
Analyzed DTS datasets from active heat injection experiments in Guelph, ON Canada is included. A .pdf file of images including borehole temperature distributions, temperature difference distributions, temperature profiles, and flow interpretations is included as the primary analyz...
Authors
Coleman, T. University of Wisconsin
geothermaldtsboreholetemperatureguelphimagespressuregradientwelldrill-holecodeontariocamatlab

Ionic Fluids for EGS: Rheological Behavior under HPHT Conditions

Sep 13, 2025
876.78 kB
Publicly accessible
This dataset contains high-pressure, high-temperature (HPHT) rheological measurements of ionic liquids and alternative geothermal fluids. Experiments were conducted at Oklahoma State University using a Chandler Model 5550 viscometer and Rheo 5000 software to evaluate the flow beha...
Authors
Maitra, E. and Al Dushaishi, M. Oklahoma State University
geothermalenergyionic liquid rheologyhpht rheologygeothermal fluid rheologyionic liquidsrheologyhphthpht conditionsdeep eutetic solventsdesgeothermal fluidsionic fluids for egsviscosityflow behaviorhigh-pressure testinghigh-temperature testingenhanced geothermal systemsegsraw datalaboratory datageochemistry

GeoDAWN Northwestern Elko County Nevada EarthMRI Data

May 15, 2023
270.41 kB
Publicly accessible
This submission includes both the original product resolution (OPR) and LiDAR point cloud (LPC) LiDAR data collected as part of GeoDAWN: Geoscience Data Acquisition for Northwestern Elko County, Nevada. The USGS Earth Mapping Resources Initiative (EarthMRI) and USGS 3D Elevation ...
Authors
National Geospatial Program, U. United States Geological Survey
geothermalenergygeodawnnevadaelkolidarremote sensing3deppoint cloudearthmriexplorationprocessed dataoprlpcmappingtifflazgreat basinwalker lanegeospatial datageotiffraster datagroundwater

PoroTomo Natural Laboratory Horizontal and Vertical Distributed Acoustic Sensing Data

Mar 29, 2016
342.13 TB
Publicly accessible
This dataset includes links to the PoroTomo DAS data in both SEG-Y and hdf5 (via h5py and HSDS with h5pyd) formats with tutorial notebooks for use. Data are hosted on Amazon Web Services (AWS) Simple Storage Service (S3) through the Open Energy Data Initiative (OEDI). Also include...
Authors
Feigl, K. et al University of Wisconsin
geothermalporotomodasfiber opticsurface sensorsseismic arraydistributed acoustic sensingporoeleastic tomographybradys geothermal fieldgeosciencedistributed sensingdownholetrenchedseismicityhydrothermalgeophysicsoediraw datajupyter notebookpythonhdf5hsdsh5pyh5pyd

Utah FORGE: Triggered DAS Data from the April 2024 Mini-Circulation Test

May 01, 2026
Size unavailable
In progress
This dataset contains distributed acoustic sensing (DAS) data collected during the April 2024 mini-circulation test at the Utah FORGE site. Data were acquired from wells 16B(78)-32 and 58-32 during the mini-circulation period from April 23-28, 2024, following stimulation of the in...
Authors
Dyer, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeegsdistributed acoustic sensingdasmini-circulation testcirculation testsegyseg-y16b78-3258-32seismic datawell trajectoriesgeophysics

GeoDAWN West Central Nevada EarthMRI Data

May 15, 2023
842.33 kB
Publicly accessible
This submission includes both the original product resolution (OPR) and LiDAR point cloud (LPC) LiDAR data collected as part of GeoDAWN: Geoscience Data Acquisition for Western Nevada. The USGS Earth Mapping Resources Initiative (EarthMRI) and USGS 3D Elevation Program (3DEP), De...
Authors
National Geospatial Program, U. United States Geological Survey
geothermalenergygeodawnnevadawesternlidarremote sensing3deppoint cloudearthmriexplorationprocessed dataoprlpcmappingtifflazcaliforniagreat basinwalker lanegeospatial datageotiffraster data

Hot Pot: Mercury Concentration Map

Jun 28, 2013
64.3 kB
Publicly accessible
Location of sample points and analytical results for mercury concentrations from a soil survey.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeochemistrysoil surveymercurymap packagegisgeospatial data

Hot Pot: Fault Summary

Jun 28, 2013
96.28 kB
Publicly accessible
Compilation of faults interpreted from seismic reflection survey and from field observations.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potseismic reflection surveyfaultsgeologymap packagegisgeospatial data

UTM Well Coordinates for the Boise Hydrogeophysical Research Site (BHRS)

Dec 19, 2014
54.02 kB
Publicly accessible
A series of oscillatory pumping tests were performed at the BHRS. The data collected from these wells will be used to tomographically image the shallow subsurface. This excel file only contains well coordinates for all wells at the Boise site.
Authors
Lim, D. University of Wisconsin
geothermalwell coordinateshydraulic tomographycharacterizationboise hydrogephysical research sitesubsurfacepumping testpump testoscillatorylocationmetadata

Utah FORGE: Tensor Strainmeter Data for the April, 2024 Stimulation of Wells 16A(78)-32 and 16B(78)-32

Sep 09, 2025
4.44 MB
Publicly accessible
This dataset contains time series data from the four Tensor Optical Fiber Strainmeters at Utah FORGE, recorded during all stages of the April 2024 hydraulic stimulations of wells 16A(78)-32 and 16B(78)-32. The data span from midnight UTC on April 4 through April 18, 2024, and are ...
Authors
Murdoch, L. Clemson University
geothermalenergystrainstrainmeterutah forgetensor strainstimulationforgeoptical fiberegshydraulic stimulationprocessed data16a78-3216b78-32strain datageomechanicstime seriesbarometric pressureslurry ratetreatment pressuregeothermal reservoirstimulation monitoring

New Mexico Play Fairway Analysis: Conservative Ion Water Chemistry Data and Chalcedony Geothermometry

Oct 21, 2015
9.57 MB
Publicly accessible
Compilation of boron, lithium, bromine, and silica data from wells and springs throughout New Mexico from a wide variety of sources. The chalcedony geothermometry calculation is included in this file.
Authors
Kelley, S. New Mexico Bureau of Geology and Mineral Resources
geothermalnew mexicosilicaboronbrominelithiumchalcedony geothermometryconservative ionsgeothermometrywater chemistrychemistryconservative ionaqueous chemistrynmpfatemperatureexplorationcharacterizationwaterplay fairway analysis

Preliminary Drill Sites

Jun 28, 2013
158.67 kB
Publicly accessible
Preliminary locations for intermediate depth temperature gradient holes and/or resource confirmation wells based on compilation of geological, geophysical and geochemical data prior to carrying out the DOE-funded reflection seismic survey.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potdrill sitestemperature gradientmap packagegisgeospatial data

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

EGS Collab Experiment 2: Distributed Fiber Optic Acoustic Data (DAS)

May 28, 2024
212.2 TB
Publicly accessible
Distributed fiber optic sensing was an important part of the monitoring system for EGS Collab Experiment #2. A single loop of custom fiber package was grouted into the four monitoring boreholes that bracketed the experiment volume. This fiber package contained two multi-mode fiber...
Authors
Rodriguez Tribaldos, V. and Hopp, C. Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 2distributed acoustic sensingdassilixaidasterra15trebleoptasenseodh3hdf5tdmsraw datastrain ratemulti-mode fibersingle-mode fibergeophysics

Geothermal Project NEPA Database

Sep 30, 2014
1.59 MB
Publicly accessible
During the 2013 fiscal year, the National Renewable Energy Laboratory (NREL) developed the Geothermal National Environmental Policy Act (NEPA) Database with funding provided by the U.S. Department of Energy (DOE) Geothermal Technologies Office (GTO). The information in the databas...
Authors
Young, K. and Levine, A. National Renewable Energy Laboratory
geothermalenergynepadatabaseopeneicasual usecucategorical exclusioncxcedetermination of nepa adequacydnaenvironmental assessmenteaenvironmental impact statementeisblmusfsfonsigtonational environmental policy actrapid toolkitgrcgeothermal resources council

EGS Collab Experiment 3: 4100 Tensile Stimulation and Thermal Circulation Testing

Aug 26, 2022
6.03 GB
Publicly accessible
These data and test descriptions are from a set of primarily tensile hydraulic-fracture stimulations in wells E2-TC and E2-TU and a subsequent chilled water circulation test conducted by injecting in well E2-TU on the 4100 level of the Sandford Underground Research Facility (SURF)...
Authors
Vermeul, V. et al Pacific Northwest National Laboratory
geothermalenergyegs collabsurfhydraulicfracturingstimulationexperimentegsflowflow testingwellinjectionproductiontensilee2-tce2-tucirculation tenstingexperiment 34100thermal circulationchilled water injectionraw datalogprocessed data

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

3-D Geologic Controls of Hydrothermal Fluid Flow at Brady Geothermal Field, Nevada using PCA

Oct 01, 2021
7.12 MB
Publicly accessible
In many hydrothermal systems, fracture permeability along faults provides pathways for groundwater to transport heat from depth. Faulting generates a range of deformation styles that cross-cut heterogeneous geology, resulting in complex patterns of permeability, porosity, and hydr...
Authors
Siler, D. and Pepin, J. United States Geological Survey
geothermalenergypca3d geologic modelgeologic modelgeologycharacterizationmachine learningmlbhsbrady hot springsprincipal component analysisproductionstressfaultsrbradyhydrothermalgeologic structureunsupervised3d well datacodegeothermicgeophysics
<< Previous123456Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service