OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 235.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"Trace element geochemistry"×

Utah FORGE 2-2439v2: Report on Predicting Far-Field Stresses Using Finite Element Modeling and Near-Wellbore Machine Learning for Well 16A(78)-32

Aug 30, 2024
973.4 kB
Publicly accessible
This report presents the far-field stress predictions at two locations along the vertical section of Utah FORGE Well 16A (78)-32 using a physics-based thermo-poro-mechanical model. Three principal stresses in far-field were obtained by solving an inverse problem based on the near-...
Authors
Lu, G. et al University of Pittsburgh
geothermalenergyutah forgein-situ stress estimationphysics-based modelingfinite element methodmachine learning modelthermo-poro-mechanical effectwell loggingvelocity-to-stress relationshipmachine learningfemreporttechnical report16a78-32mlegs2-2439v2principal stressstress predictionfar-fieldpre-cooling

West Flank Coso FORGE: ArcGIS Data for Geologic Model

Mar 01, 2016
154.12 kB
Publicly accessible
Archive of ArcGIS data from the West Flank FORGE site located in Coso, California. Archive contains the following eight shapefiles: Polygon of the 3D geologic model (WestFlank3DGeologicModelExtent) Polylines of the traces 3D modeled faults (WestFlank3DModeledFaultTraces) Polyline...
Authors
Sandia National Laboratories
geothermalforgewest flankegscosoarcgis datacross-sectionseismic reflectionwell pathwell collarfault tracewell pathswell collarsgeospatial datamodelgeologygeologicfaulttracecalifornia

Hawaii Play Fairway Analysis: Noble Gas Raw Data for Hawaii, Maui, Oahu, Kauai, and Lanai islands

Oct 06, 2020
141.44 kB
Publicly accessible
Noble gas raw data for the Hawaiian islands of Big Island, Maui, Oahu, Lanai, and Kauai. Based on results from prior phases of the Hawaii Play Fairway Analysis, this project targeted 66 wells on the islands of Hawaii, Maui, Lanai, Oahu, and Kauai for sampling of dissolved noble ga...
Authors
Ferguson, C. and Lautze, N. University of Hawaii
geothermalenergyhawaiiplay fairwaylanaikauaioahunoble gasmauigeochemistryr/rar/ra anomoliesindicatorssurveyriftlower east rift of kilaueasouthwest rift of haleakalarift zonescalderasheliumcalderapfaplay fairway analysisgas datanoble gas dataraw datawell

Experimental Parameters Affecting Stripping of Rare Earth Elements from Loaded Sorptive Media in Simulated Geothermal Brines

May 24, 2016
247.65 kB
Publicly accessible
Experimental results from several studies exploring the impact of pH and acid volume on the stripping of rare earth elements (REEs) loaded onto ligand-based media via an active column. The REEs in this experiment were loaded onto the media through exposure to a simulated geother...
Authors
Stull, D. Tusaar Corp.
geothermalmediarare earth elementsmedia strippingphreemineral recoveryadsorptioncolumnelutionexperimentsimulated brinerare earth elementbrine study

Epidote Rare Earth Element Analyses from Wells RN-12 and RN-19 Reykjanes, Iceland

Jan 01, 2015
1.51 MB
Curated
Results for laser ablation measurement of rare earth elements and electron microprobe analysis of major elements in hydrothermal epidote from the Reykjanes geothermal system in Iceland. Laser ablation measurements were completed using an Agilent 7700 quadrupole ICP-MS coupled with...
Authors
Fowler, A. and Zierenberg, R. University of California
geothermalepidoterare earth elementsreykjanesicelandrn-12rn-30aasg content modelusgin content modelngds content modelcontent modelreemineral recoverybrinebrine study

Finite Element Analysis (FEA) for Water-Foam Fracturing of Granite Rock

May 04, 2021
11.74 GB
Publicly accessible
In addition to the foam data that were obtained from literature and that were collected from the current study, simulation data was also generated from finite element analysis (FEA) conducted in this study using COMSOL Multiphysics software. The FEA models were built to simulate t...
Authors
Thakor, V. et al Temple University
finite element analysisenhanced geothermal systemfoam fracturinggraniteegsgeothermalenergysimulationfeamodelcomsolsolid mechanicsfoam fracturing fluidfoamfracturing fluid

Fallon FORGE: Distinct Element Reservoir Modeling

Mar 12, 2018
57.97 MB
Publicly accessible
Archive containing input/output data for distinct element reservoir modeling for Fallon FORGE. Models created using 3DEC, InSite, and in-house Python algorithms (ITASCA). List of archived files follows; please see 'Modeling Metadata.pdf' (included as a resource below) for addition...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyegsforgefallonnevadastresshydro-shearinghydraulic fracturesgeomechanicsthermalmicroseismicitygeometrycirculationstimulationreservoir modelvetted-nopython codescriptmicroseimicwell trajectoriesfracture aperturehydroshearingstereonet plotspercent fracture slip vs pressureinjectionstressesdfngeologic structurejoint networkleakoff ratioshear stimulatedshear displacementnormal displacementopenholecasedthermal drawdownseismicitywell locationsreservoir mappingmiocroearthquakesmeqthermal modelingfracture tendancymicroseismicanalysisanalysesmodellingmodelreservoir

Utah FORGE: Triggered DAS and Continuous Downhole Geophone Data from April 2024 Stimulations

Apr 01, 2024
35.23 TB
Curated
This dataset contains distributed acoustic sensing (DAS) and downhole geophone data collected during the April 2024 stimulation experiments at the Utah FORGE site. DAS data were acquired from well 16B(78)-32 by Neubrex and processed by GeoEnergie Suisse (GES), covering the period ...
Authors
Dyer, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeegsdasdistributed acoustic sensingseismictriggered eventsgeophonesdownholedownhole seismicneubrexgeoenergie suissegesaprill 2024stimulationhydraulic fracturingcountinuous dataraw dataprocessed datageophysics58-3216b78-3256-32monitoring well

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Generalized Displacement Correlation Method for Estimating Stress Intensity Factors

Jan 01, 2012
1.25 MB
Publicly accessible
This paper presents a generalized form of the displacement correlation method (the GDC method), which can use any linear or quadratic finite element type with homogeneous meshing without local refinement. These two features are critical for modeling dynamic fracture propagation pr...
Authors
Fu, P. et al Lawrence Livermore National Laboratory
geothermalfracture mechanicsstress intensity factordisplacement correlation methodquarter-point elementfracture propagationfracture interactiongdcgeneralized

Simulating Complex Fracture Systems in Geothermal Reservoirs Using an Explicitly Coupled Hydro-Geomechanical Model

Jan 01, 2011
6.5 MB
Publicly accessible
Low permeability geothermal reservoirs can be stimulated by hydraulic fracturing to create Enhanced (or Engineered) Geothermal Systems (EGS) with higher permeability and improved heat transfer to increase heat production. In this paper, we document our effort to develop a numerica...
Authors
Carrigan, C. et al Lawrence Livermore National Laboratory
geothermalrock mechanicshydraulic fracturingenhanced geothermal systemegssimulationhydrohydrofrackingflowmodelmodelingreservoirfracking

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin

Utah FORGE 2439: Well 16B(78)-32 Field-Test Data from Mini-Frac Tests

Jul 02, 2023
2.73 GB
Publicly accessible
This submittal includes the field-test data collected during stress tests conducted in the Utah FORGE 16B(78)-32 wellbore to measure/characterize the stresses in the geothermal reservoir. The type of stress test performed is referred to as a mini-frac test or a micro-frac test. Th...
Authors
Kelley, M. et al Battelle Memorial Institute
geothermalenergygeomechanicsutahforgeminifracstressin-situ stressegsmini-fracstress testgeophysical logimage logacoustic logsonic logfracturinghydraulic fracturingreservoir stressinjectioncaliper logstemperature logsxmac16b78-32baker hughespacker element pressureflowbackpacker element

Play Fairway Analysis CA-NV-OR: Geochemistry Data (Play Fairway Area Only)

Aug 05, 2015
145.32 MB
Curated
Subset of all Aqueous Geochemistry, selected for UCD PF area only.
Authors
M, C. University of California
geothermalaqueousgeochemistryaqueous geochemistryca-nv-orpfaplay fairway analysischaracterizationgeospatial datacalifornianevadaoregon

Utah FORGE 2-2439v2: A Multi-Component Approach to Characterizing In-Situ Stress Final Report

Dec 22, 2025
2.43 MB
Curated
This comprehensive technical report documents a multi-component approach to in-situ stress characterization at the Utah FORGE EGS site that integrates Machine Learning (ML) methods for predicting near-well principal stresses around geothermal wells with the physics-based finite el...
Authors
Bunger, A. et al University of Pittsburgh
geothermalenergyin-situ stress estimationutah forgewave velocitythermo-poro-elastic modelingmachine learningegsnear-wellbore stressfar-field principal stressstress anisotropyphysics-based modelingfinite element modelingsonic logtuvtechnical reportreservoir characterization

Topographic and Air-Photo Lineaments in Various Locations Related to Geothermal Exploration in Colorado

Feb 01, 2012
235.87 kB
Publicly accessible
These line shapefiles trace apparent topographic and air-photo lineaments in various counties in Colorado. It was made in order to identify possible fault and fracture systems that might be conduits for geothermal fluids, as part of a DOE reconnaissance geothermal exploration prog...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalstructurelineamentsair-photoscoloradoalamosa countyarcheluta countychaffee countydelta countydolores countyeagle countygarfield countymineral countypark countyroutt countysan miguel countyshapefileshape fileexplorationgisarcgisgeospatialdatageospatial datageochemistry

Play Fairway Analysis CA-NV-OR: Geochemistry Data

Aug 05, 2014
120.19 MB
Publicly accessible
Tabular aqueous geochemistry data files for the Play Fairway Analysis CA-NV-OR area.
Authors
M, C. University of California
geothermalgeochemistryaqueouscalifornianevadaoregonpowell and cummingchemistryheliumpfaplay fairway analysisca-nv-orcharacterization

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Exploration for Blind Geothermal Resources in the State of Hawaii Utilizing Dissolved Noble Gasses in Well Waters

Nov 01, 2020
139.07 kB
Publicly accessible
This study is an extension of the Hawaii Play Fairway Analysis (PFA), a statewide geothermal exploration project funded by the United States Department of Energy. Based on results from prior phases of the PFA, this project targeted 66 wells on the islands of Hawaii, Maui, Lanai, O...
Authors
Ferguson, C. University of Hawaii
geothermalenergyhawaiiplay fairwaykilaueamauilanaikauainoble gasheliumtrace metalr/raisotopeindicatorindicator gasresource detection

Utah FORGE: Triggered DAS Data from the April 2024 Mini-Circulation Test

May 01, 2026
Size unavailable
In progress
This dataset contains distributed acoustic sensing (DAS) data collected during the April 2024 mini-circulation test at the Utah FORGE site. Data were acquired from wells 16B(78)-32 and 58-32 during the mini-circulation period from April 23-28, 2024, following stimulation of the in...
Authors
Dyer, B. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeegsdistributed acoustic sensingdasmini-circulation testcirculation testsegyseg-y16b78-3258-32seismic datawell trajectoriesgeophysics

Raft River Geothermal Field Well Head Brine Sample

Dec 18, 2015
81.13 kB
Publicly accessible
Raw data and data workup of assay for real-world brine sample. Brine sample was taken at the well head.
Authors
Lanyk, T. Tusaar Corp.
geothermalbrineassayreesfield samplewater chemistry analysisrare earth elementbrine chemistybrine water chemistry

Validation of Innovative Exploration Technologies for Newberry Volcano: Geochemistry Data from Wells 55-29 and 46-16

Jan 01, 2012
Size unavailable
Publicly accessible
Validation of Innovative Exploration Technologies for Newberry Volcano: DOE Geochemistry data from deep wells 55-29 and 46-16 at Newberry 2012
Authors
Jaffe, T. Davenport Newberry Holdings, LLC
newberryvolcanooregoncalderainnovative exploration technologiesgeochemistrydatawellsiet55-2946-16deepwellexplorationhydrothermalegs

Magnetic Test Loop Particle Retention Data for REE Extraction from Geothermal Fluids

Jul 27, 2018
396.3 kB
Publicly accessible
Measurements of particle extraction efficiency under various flow rate and magnetic power conditions
Authors
McGrail, P. and Liu, J. Pacific Northwest National Laboratory
geothermalenergymineral extractionreerare earthretentionoperationratecomparisonnanoparticleabsorbancemagneticextractionelementmineralparticle

Stimulation at Desert Peak Modeling with the Coupled THM Code FEHM

Apr 30, 2013
223.65 MB
Publicly accessible
Numerical modeling of the 2011 shear stimulation at the Desert Peak Well 27-15 using a coupled thermal-hydrological-mechanical simulator. This submission contains the finite element heat and mass transfer (FEHM) executable code for a 64-bit PC Windows-7 machine, and the input and ...
Authors
Kelkar, S. et al Los Alamos National Laboratory
geothermalshear stimulationmodelingegsfehmthmthermal-hydrological-mechanicalsimulationstimulation

Utah FORGE: North Milford Groundwater Geochemistry

Jun 20, 2019
1.06 MB
Publicly accessible
This dataset contains groundwater geochemistry from several wells in North Milford Valley, Utah, in the region of the Utah FORGE project (Phase 2c). Readme file that discusses the data contained in the Excel spreadsheet. Data include GPS coordinates (UTM, Lat-Long), sampling tempe...
Authors
Simmons, S. and Kirby, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegroundwaternorth milford valleygeochemistrygroundwater geochemistrywater chemistryforgeutahsamplingmilfordegsisotopetemperatureroosevelt hot springsion balancegwgeospatial dataresourcecharacterization
<< Previous1234567Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service