OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 260.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"rock properties"×

WHOLESCALE Catalog of Rock Samples at San Emidio Nevada collected in January 2021 Version 2.0

Jan 12, 2021
21.28 kB
Publicly accessible
This submission includes an update to the WHOLESCALESamples2021January.xls file where the strikes and dips initially reported have been corrected to comply with the right hand rule. The updated excel file and a link to the original submission are included in this report. The ori...
Authors
Kleich, S. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsan emidionevadarock samplesgeologyimagesphotoscore samplesgeophysicssamplesrockraw data

Data Arrays for Microearthquake (MEQ) Monitoring using Deep Learning for the Newberry EGS Sites

May 05, 2021
11.59 GB
Publicly accessible
The 'Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties' project looks to apply machine learning (ML) methods to Microearthquake (MEQ) data for imaging geothermal reservoir properties and forecasting seismic events, in order to...
Authors
Zhu, T. Pennsylvania State University
geothermalenergycodedeep learningmachine learningaiartificial intelligenceegsenhanced geothermal systemsengineered geothermal systemsnewberryoregonnewberry volcanomlraw dataprocessed datamicroseismicitynumpywaveformpreprocessedpythonnewberry volcanic sitemicroearthquakemeqseismicgeophysicsgeophysical

Deep Direct-Use Feasibility Study Estimation of Reservoir Properties for the Tuscarora Sandstone

Dec 19, 2019
56.41 MB
Publicly accessible
This dataset contains black-and-white photographic images of individual core segments from well Preston 119 and photomicrographs taken of petrographic thin sections from well Clay 513. Minipermeameter measurement results of 2,260 samples for fracture and matrix permeability on cor...
Authors
McDowell, R. West Virginia University
geothermalappalachian basinwvuwvgestuscarora sandstonethin section analysisminipermeameterpermeabilityddudeep direct-usematrix permeabilitycore segmentsfracture analysisreservoir analysisphotomicrographsfracture permeabilityfeasibilityreservoirgeologicthermalpropertiesthicknessdepthcharacterizationwvegs

Deep Direct-Use Feasibility Study Temperature-Depth Estimates for West Virginia University, Morgantown, WV

Dec 19, 2019
1.44 MB
Publicly accessible
This dataset contains data spreadsheets and figures that summarize the results of a stochastic analysis of temperatures at depth below the West Virginia University campus in Morgantown, WV. These results are extracted from a study by Smith (2019), whose results are included in a G...
Authors
Smith, J. West Virginia University
geothermalappalachian basinwvucornelllow-temperature geothermalresource assessmentuncertainty analysisddudeep direct-usemorgantownmonte carlo analysistemperature-depth estimateslow-temperatureresource potentialegstemperature datadepth data

Alternative CAES Technology Using Depleted Unconventional Gas Wells and Subsurface Thermal Energy Storage (GeoCAES)

May 23, 2019
413.08 kB
Publicly accessible
This project assessed the technical viability of a process called GeoCAES. The process stores electrical energy by injecting natural gas into shale gas formations using a compressor, storing it, and producing it through an expander to generate electricity. This data submission inc...
Authors
Johnston, H. and Young, D. National Renewable Energy Laboratory
geothermalenergyenergy storagenatural gasunconventional shalegeocaesmodelwellgeothermal energy storagegeothermal reservoirsurface plantfeasibilitytechnologytestechnicaltechnical assesmentcodeprocessed data

SGW paper Rheological Properties of Drilling Fluids Containing Special Additives for Geothermal Drilling Applications

Jan 04, 2023
1.3 MB
Publicly accessible
The paper was presented at the 46th Workshop on Geothermal Reservoir Engineering, Stanford University, Stanford, California, February 15-17, 2021. In this study, the effectiveness of different additives was evaluated in maintaining drilling fluid rheology at HPHT(high pressure and...
Authors
Mohamed, A. et al University of Oklahoma
geothermalrheologydrilling fluid additivesviscosifierfiltration controlgeothermal drillinghphtgeochemistrywellboredrilling technologyexperimenttechnologyreportsgwwelltemperature

Utah FORGE 5-2565: Hydrothermal Evolution of Fracture Properties 2023 Annual Workshop Presentation

Sep 08, 2023
99.84 MB
Curated
This is a presentation on the Evolution of Permeability and Strength Recovery of Shear Fractures Under Hydrothermal Conditions project by the U.S. Geological Survey, presented by Dr. David Lockner. The project's objective was to determine how thermal, hydraulic, mechanical, and ch...
Authors
Lockner, D. et al United States Geological Survey
geothermalenergyannual workshop2023utah forgeegsfracture propertiesthmcpermeabilityfracture strengthmicromechanicalempiricalfracture modelsgeophysicsnumerical modelthermal couplingreservoir longevityfracture evolutionhydrothermalgeomechanicalgeochemicalpresentation

EGS Collab Experiment 2: Core Photographs and Descriptions

Aug 05, 2021
136.42 GB
Publicly accessible
This submission contains photographs of rock core collected from EGS Collab Experiment 2 (and 3) boreholes. Cores were generally photographed in about 1-foot sections using Nikon D3300 DSLR cameras from two angles about 90 degrees apart, wet and dry. Core photos are provided here ...
Authors
Kneafsey, T. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabexperiment 24100 levelsanford underground research facilitycore photographscoredrillinggeologysurfpanoramic photographscore logsanomaly logs

2016 Passive Seismic Imaging of the Dixie Valley Geothermal Well Field for EGS Favorability and Fault Mapping

Nov 01, 2015
343.78 MB
Publicly accessible
This submission provides reports on the results of seismic data analyses, statistical data sets of rock properties under the DVGWF, GIS data for new maps of EGS favorability, and a link to raw seismogram data archived by the IRIS-DMS.
Authors
Louie, J. et al University of Nevada, Reno
geothermalenergydixie valleynevadapassiveseismicreflectionegsfaultfavorabilitygeospatial dataarcgisgispsdcwtcdpgeophysicsgeophysicalinterferometryambient noisetechnical reportreportseismogramraw

WHOLESCALE Catalog of Rock Samples at San Emidio Nevada collected in January 2021

Jan 12, 2021
857.7 MB
Publicly accessible
This submission contains information on thirty-six rock samples collected from San Emidio, Nevada during January, 2021 for Subtask 2.3 of the WHOLESCALE project. The following resources include a .zip of rock sample photos taken in the field, a .zip of rock sample photos taken in ...
Authors
Kleich, S. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsan emidionevadarock samplesfieldsamplessamplerock samplegeologyimagesphotoscore samples

Utah FORGE: Phase 3 Native State Model 2022 Update

Jul 29, 2022
326.43 MB
Publicly accessible
This is the Phase 3 native state model update. The Phase 3 numerical model represents a significant subsurface volume below the FORGE site footprint. The model domain of 4.0 km x 4.0 km x 4.2 km is located approximately between depths of 4000 to 4200 meters below land surface. Thi...
Authors
Podgorney, R. and Liu, R. Idaho National Laboratory
geothermalenergyutah forgenative state modelstresspressuretemperature16a78-3256-3258-3278-3278b-32fracturespore pressurereservoir potentialraw datasimulationmodelinputinput filesprocessed datawater

Technical Report-Rare Earth Element Data Associated with Oil and Gas Reservoir Rock

Jul 01, 2017
4.49 MB
Publicly accessible
This work was developed to complement the geochemical assessments of produced water and geothermal water samples. Specifically, this task was designed to test the influence of reservoir rock-type and corresponding mineralogy/geochemistry on the concentrations of REE found in oil a...
Authors
McLaughlin, J. et al University of Wyoming
geothermalenergyrare earth elementproduced watersreecoproducedresourcesgeochemicalisotope concentrationgeochemistryoil and gasconcentrationgeologyrock chemistrygeologicinfluenceminerologybrine study

Utah FORGE 5-2565: Evolution of Permeability and Strength Recovery of Shear Fractures Under Hydrothermal Conditions 2024 Annual Workshop Presentation

Sep 15, 2024
82.63 MB
Publicly accessible
This is a presentation on the Evolution of Permeability and Strength Recovery of Shear Fractures Under Hydrothermal Conditions by United States Geological Survey, presented by Tamara Jeppson. This video slide presentation, by the USGS, discusses the determination of how thermal, ...
Authors
Jeppson, T. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeusgsthmcthermalhydrologicmechanicalchemicalfracture networksfractures propertiesfracturesmodes of reactionempirical fracture modelsmicromechanical

Utah FORGE 3-2535: Joint EM-Seismic-InSAR Imaging of Fracture Properties 2023 Annual Workshop Presentation

Sep 08, 2023
81.78 MB
Curated
This is a presentation on the Joint Electromagnetic/Seismic/InSAR Imaging of Spatial-Temporal Fracture Growth and Estimation of Physical Fracture Properties During EGS Resource Development project by Lawrence Berkeley National Laboratory, presented by Dr. David Alumbaugh, Staff Sc...
Authors
Alumbaugh, D. Lawrence Berkeley National Laboratory
geothermalenergyannual workshop2023utah forgeegsem modelinginsarem data aquisitionpassive seismicactive source borehole emfracture generationfracture growthreservoir characterizationreservoir imagingworkflowsteel casingem surveyem data processingpresentation

Memos Relating to High-Priority Geothermal Targets in Colorado Selected for Further Study Flint Geothermal 2012

Feb 27, 2014
7.57 MB
Publicly accessible
This dataset contains several memos describing geothermal targets outlined by Flint personnel in Colorado. Phase 1 involved an ASTER and LANDSAT thermal infrared imagery assessment conducted by CIRES of the University of Colorado, which identified areas of warm ground that might i...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalcoloradoremote sensingground truthasterthermal infraredroutt hot springsstrawberry park hot springsricopagosa springslemon hot springssan luis valleypenrosefremont countycanon city

Testing LCM on a Large Scale for Geothermal Drilling Applications Using a Novel Experimental Setup

Apr 22, 2022
15.98 MB
Publicly accessible
Rheology data obtained from flow loop tests, performed using different lost circulation materials (LCM) to study their effect on fluid rheology and wellbore hydraulics. The sealing performance of different LCM was tested using different fracture sizes. Five academic papers / repor...
Authors
Mohamed, A. et al University of Oklahoma
geothermal drillinglost circulationsealing efficiencyrheologyhigh temperatureflow loop3d printingtemperaturecharacterizationdrilling fluid additivesshape memory polymergeothermal wellshpht challengesdrilling fluidwellbore hydraulicshole cleaningfluid stabilitysmart lcmht flow looplost circulation materialannular flowrheological propertiesgeothermalenergyviscosifierfiltration controlhphtgeochemistrywellboredrilling technologyexperimenttechnologyreportsgwmodeldrillingprocessed data

Processed Lab Data for Neural Network-Based Shear Stress Level Prediction

May 14, 2021
6.01 MB
Publicly accessible
Machine learning can be used to predict fault properties such as shear stress, friction, and time to failure using continuous records of fault zone acoustic emissions. The files are extracted features and labels from lab data (experiment p4679). The features are extracted with a n...
Authors
Marone, C. et al Pennsylvania State University
geothermalenergymatlabgeophysicsseismiccodeprocessed datamicroseismicityaiartificial intelligencedeep learningmachine learningacousticsacoustic emissionsseismic forcastingseismic predictionfaultfault propertiesshear stresstime to failureexperimentexperimental datalab databiaxial shear experimentbiaxial shear apparatusfriction

Utah FORGE 5-2615: Well 58-32 and 78-32 Poroelastic Properties

Oct 31, 2022
59.49 MB
Curated
This dataset contains laboratory measurements of poroelastic properties of granite samples from Utah FORGE wells 58-32 and 78-32. The data include permeability, grain bulk modulus, drained bulk modulus, Skempton's pore pressure coefficient, and Biot's effective stress coefficient....
Authors
Ghassemi, A. and Zhou, X. University of Oklahoma
geothermalenergyporoelasticityutah forgeeffective stressbulk modulusgrain modulusporoelastic expansion coefficientpermeabilityutah58-3278-32pore pressureconfining pressureskemtpon coefficientgeologyprocessed data

Self-Healing and Re-Adhering Polymer-Cements with Improved Toughness

Nov 11, 2015
16.14 MB
Publicly accessible
Polymer-cement experiments were conducted in order to assess the chemical and thermal properties of various polymer-cement composites. This file set includes the following polymer-cement analyses: Polymer-Cement Composite Synthesis Polymer-Cement Interactions by Atomistic Simulat...
Authors
Fernandez, C. Pacific Northwest National Laboratory
geothermalself-healingcementpolymerwellbore integritywater to cementratiopolymer mass percentageatomistic simulationsradial distribution functioncompressive strengthfracture toughnesspolymer-cementftirfourier transform infrared spectroscopychemical analysissulfuric acidco2thermal shockbrinebulk thermal propertiesh2so4attackmineral acidresistanceconsistencyflowabillitydynamic yield strengthrheologypermeabilitysemedxelemental compositionmicrostructurecompositional analysisthermogravimetric analysistotal carbon analysistoctictgatotal organic carbontotal inorganic carbonx-ray diffractionwellbore cementtechnologyintegritywellbore

Resource Analysis for Deep Direct-Use Feasibility Study in East Texas

Jun 28, 2018
20.79 MB
Publicly accessible
The National Renewable Energy Laboratory, Southern Methodist University Geothermal Laboratory, Eastman Chemical, Turbine Air Systems, and the Electric Power Research Institute are evaluating the feasibility of using geothermal heat to improve the efficiency of natural gas power pl...
Authors
Richards, M. et al Southern Methodist University
geothermalenergyeast texastravis peaksabine uplifthosstonsligocotton valleylongvieweastman chemicalreservoir productivity indexrpiheatflowheat flowsmusouthern methodist universitynrelbottom hole temperaturebhtabsorption chillpresentationmemodatapaperpublicationjournal articleddutxfeasibilitydeep direct-use

Utah FORGE 5-2615: Determination and Analysis of Thermo-poromechanical Response of Fractured Rock 2024 Annual Workshop Presentation

Sep 01, 2024
63.48 MB
Publicly accessible
This is a presentation on the Determination and Modeling-Informed Analysis of Thermo-poromechanical Response of Fractured Rock for Application to FORGE by the University of Oklahoma, presented by Ahmad Ghassemi. This video presentation discusses how to improve understanding and co...
Authors
Ghassemi, A. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeuniversity of oklahomatpmthermo-hydro-mechanicalrock mechanicsporositythermoporomechanicaldfitreservoir stress modellingrock stressmicro-seismicityegsvideopresentation

Utah FORGE 2439: A Multi-Component Approach to Characterizing In-Situ Stress

Dec 13, 2022
201.16 MB
Publicly accessible
Core-based in-situ stress estimation, Triaxial Ultrasonic Velocity (labTUV) data, and Deformation Rate Analysis (DRA) data for Utah FORGE well 16A(78)-32 using triaxial ultrasonic velocity and deformation rate analysis. Report documenting a multi-component approach to characterizi...
Authors
Bunger, A. et al Battelle Memorial Institute
geothermalenergyutah forgein-situ stresslaboratorymodelingfield measurementtuvtriaxial ultrasonic velocitydeformation rate analysisdraweight of evidencewoeegsstress testcharacterizationwell datageophysicsforge16a78-32

Literature Data on Foam Fracturing Fluid

Nov 08, 2021
103.25 kB
Publicly accessible
At the beginning of this project, the Temple team spent significant effort to collect data relevant to foam fracturing. More than 40 articles/reports were found in the open literature that reported the properties of aqueous foams under various testing conditions. The foam properti...
Authors
Thakor, V. et al Temple University
geothermalenergyenhanced geothermal systemsfoam fracturing fluidsfoamfoam fracturingdataliterature reviewdata collectionprocessed datareference

STRESSINVERSE Software for Stress Inversion

Oct 31, 2018
Size unavailable
Publicly accessible
The STRESSINVERSE code uses an iterative method to find the nodal planes most consistent with the stress field given fault frictional properties. STRESINVERSE inverts the strike, rake and dip from moment tensor solutions for the in-situ state of stress. The code iteratively solves...
Authors
Gritto, R. Array Information Technology
geothermalenergystress inversioninversionstressseismicanalysisstressinversejointfault orientationmatlabcodenumericalmomenttensorsoftwarepassivefaultfaultingearthquakeorientationgeophysicsgeophysicalmicroseismicityinducedseismicitystimulationegsinjectionfracturemonitoringhydraulicgeneration

Chemical Impact of Elevated CO2 on Geothermal Energy Production

Jan 01, 2013
2.13 MB
Publicly accessible
Numerical simulations have shown that the use of supercritical CO2 instead of water as a heat transfer fluid yields significantly greater heat extraction rates for geothermal energy. If this technology is implemented successfully, it could increase geothermal energy production and...
Authors
Carroll, S. et al Lawrence Livermore National Laboratory
geothermalco2-egsgeochemical reactionco2egsgeochemistrydissolutionprecipitationsequestrationsimulationchlorite dissolution kineticsmineral scalingmineral alterationfracture permeabilitygeochemical alterationmodelingtaupo volcanic zonenew zealandgreywackerhyolitedaciteegs-co2rock-gas interaction
<< Previous1234567Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service