OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 51 - 75 of 452.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"seismic reflection survey"×

3-D Geologic Controls of Hydrothermal Fluid Flow at Brady Geothermal Field, Nevada using PCA

Oct 01, 2021
7.12 MB
Publicly accessible
In many hydrothermal systems, fracture permeability along faults provides pathways for groundwater to transport heat from depth. Faulting generates a range of deformation styles that cross-cut heterogeneous geology, resulting in complex patterns of permeability, porosity, and hydr...
Authors
Siler, D. and Pepin, J. United States Geological Survey
geothermalenergypca3d geologic modelgeologic modelgeologycharacterizationmachine learningmlbhsbrady hot springsprincipal component analysisproductionstressfaultsrbradyhydrothermalgeologic structureunsupervised3d well datacodegeothermicgeophysics

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Utah FORGE: High-Resolution DAS Microseismic Data from Well 78-32

Oct 20, 2019
7.42 MB
Publicly accessible
This regards a high-resolution DAS microseismic dataset produced by Silixa from Utah FORGE Phase 2C seismic monitoring well 78-32 during stimulation testing of well 58-32. It is a very large dataset and as such it is currently not directly available on GDR. However, it is availabl...
Authors
Martin, T. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeutah geothermalmicroseismic datasilixa microseismic datawell 78-32 microseismic datawell 58-32 stimulation seismicityforge phase 2csilixawell 58-32well 78-32utahmilfordroosevelt hot springssegyseg-ydasdistributed acoustic sensingdxsmicroseismicitydasvmonitoringwell locationwell datadtsdistributed temperature sensingprocessed datageophysicsstimulationraw data

Hot Pot: Complete Bouguer Gravity Map

Jun 28, 2013
88.7 kB
Curated
Contoured Bouguer gravity survey with lease block outline in 2010 and location of hot springs.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeophysicsgravity surveymetadatabouger anomalygravity mapmap packagegisgeospatial data

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

Machine Learning to Identify Geologic Factors Associated with Production in Geothermal Fields: A Case-Study Using 3D Geologic Data from Brady Geothermal Field and NMFk

Oct 01, 2021
5.68 MB
Publicly accessible
In this paper, we present an analysis using unsupervised machine learning (ML) to identify the key geologic factors that contribute to the geothermal production in Brady geothermal field. Brady is a hydrothermal system in northwestern Nevada that supports both electricity producti...
Authors
Siler, D. et al United States Geological Survey
geothermalenergynmfkbrady hot springsmachine learningmlbhsnonnegative matrix factorization k-meanshydrothermalbradyk-meansclusteringnonnegative matrix factorizationmatrix factorizationgeothermalcloudsmarttensorsunsupervised3d well data3d geologic mapgeologic structurefaultsstressgeologycharacterizationgeologic modelproductioncode

Washington State Play Fairway Analysis Passive Monitoring of St. Helens Shear Zone for Tomography and Precision Microseismic Event Detection

Oct 03, 2017
16.49 MB
Publicly accessible
Data resources were derived from a passive seismic survey of the northern St. Helens Shear Zone on geothermal leases 12-24 km north of Mount St. Helens for phase 2 of the Geothermal Play-Fairway Analysis of Washington State Prospects. A 20 seismic station array of broadband seismo...
Authors
Swyer, M. et al AltaRock Energy Inc
geothermalenergyexplorationpassive seismic monitoringpassive seismic tomographyambient noise tomographymicro-seismicitywashington statest. helens shear zonemount st. helensvpvsvp/vsfocal mechanismsrelocated seismic eventsmt st helensmount saint helensmt saint helensvelocityseismicsite assessmentresource assessmentsite investigationpfatomographygeophysics

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Utah FORGE 3-2535: Joint EM-Seismic-InSAR Imaging of Fracture Properties 2023 Annual Workshop Presentation

Sep 08, 2023
81.78 MB
Curated
This is a presentation on the Joint Electromagnetic/Seismic/InSAR Imaging of Spatial-Temporal Fracture Growth and Estimation of Physical Fracture Properties During EGS Resource Development project by Lawrence Berkeley National Laboratory, presented by Dr. David Alumbaugh, Staff Sc...
Authors
Alumbaugh, D. Lawrence Berkeley National Laboratory
geothermalenergyannual workshop2023utah forgeegsem modelinginsarem data aquisitionpassive seismicactive source borehole emfracture generationfracture growthreservoir characterizationreservoir imagingworkflowsteel casingem surveyem data processingpresentation

Tularosa Basin Play Fairway Analysis: Weights of Evidence; Mineralogy, and Temperature Anomaly Maps

Nov 15, 2015
915.34 kB
Publicly accessible
This submission has two shapefiles and a tiff image. The weights of evidence analysis was applied to data representing heat of the earth and fracture permeability using training sites around the Southwest; this is shown in the tiff image. A shapefile of surface temperature anomali...
Authors
Brandt, A. University of Utah
geothermaltularosa basinnewmexicotexasoutcrop mineralogyasteregsweights of evidencewofepfatemperatureanomaliythermal infraredsurfaceanomaliestularosabasinnew mexicoplay fairway anlaysisoutcropmineralogygeospatial data

EGS Collab Experiment 2: Continuous Active Source Seismic Monitoring (CASSM)

Jan 06, 2025
15.42 GB
Publicly accessible
The dataset contains continuous active-source seismic monitoring (CASSM) data collected during EGS Collab Experiment 2, conducted from February to September 2022 at the Sanford Underground Research Facility in Lead, South Dakota. This experiment aimed to investigate enhanced geoth...
Authors
Hopp, C. et al Lawrence Berkeley National Laboratory
geothermalenergyegs collabcassmseismicactive-sourcesurfstimulationcrosswellseismic monitoringraw data3caccelerometerthre componentcalibrationtechnical reportborehole arrayshot recordsactive-source monitoringexperiment 2triggeredtriggered recording systemgeophysicsegs

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

Utah FORGE: UGS Interactive Geoscience Map

Jan 01, 2021
Size unavailable
Publicly accessible
This is a link to the Utah Geological Survey's Utah FORGE Interactive Geoscience Map. The map layers include information on geology, geography, subsurface temperatures, seismicity, gravity and groundwater. Instructions for using the interactive map and a legend for the interactive...
Authors
Hill, J. Utah Geological Survey
geothermalenergyutah forgeinteractive mapgeology mapgravity maptemperature mapseismicity mapgroundwater mapugs mapsutah geological survey mapsutah forge mapsmapgeologyseismiclstgroundwaterhydrologyugsutahforgeinteractivegravityprocessed datageospatial datawater table depthgroundwater chemistrywellfaultwell temperaturetemperaturebedrockbedrock surfacebeddingfoliationcontactgeographycharcterizationegsmilfordroosevelt hot springsenhance geothermal systemengineered geothermal system

Washington Geothermal Play Fairway Analysis Data From Potential Field Studies

Dec 20, 2017
277.52 MB
Publicly accessible
A recent study which adapts play fairway analysis (PFA) methodology to assess geothermal potential was conducted at three locations (Mount Baker, Mount St. Helens seismic zone, and Wind River valley) along the Washington Cascade Range (Forson et al. 2017). Potential field (gravity...
Authors
Anderson, M. et al Washington Geological Survey
geothermalenergygravitymagneticspotential fieldsplay fairwaywashingtonland useprocess watertransmissionurban areaswatershapefilearcgisgeospatial datagissite assessmentsite characterizationgeophysicsgeophysicalsurveyexplorationinvestigationpfawashington state

Elevation Grid for top Columbia River Basalt (CRBG) in the Portland Basin used in DDU Feasibility Study

Dec 01, 2018
41.13 MB
Publicly accessible
The Portland Basin is a prime location to assess the feasibility of DDU-TES because natural geologic conditions provide thermal and hydraulic separation from overlying aquifers that would otherwise sweep away stored heat. Under the Portland Basin, the lower Columbia River Basalt G...
Authors
Bershaw, J. and Scanlon, D. Portland State University
geothermalenergyddudeep direct-useelevationsportland basinarcgisgeospatial datagiscrbgstructure mapcross sectiongeologyfeasibilityportlandoregondemdigital elevation mapseismicwell dataoutcropsurveymapcross-sectionddu-testhermal energy storagecolumbia river basalt grouptes

Snake River Plain Play Fairway Analysis: Phase 2 Report and Phase 3 Proposal

Sep 05, 2017
33.13 MB
Publicly accessible
This report presents the results of Phase 2 of the Snake River Plain Play Fairway Analysis project, and a summary of proposed work for Phase 3. Phase 2 focused on new data collection in specific areas of interest identified in Phase 1. These data include new magnetotelluric, seism...
Authors
Shervais, J. et al Utah State University
geothermalenergyplay fairway analysissnake river plainmountain homecamas prairiebostic-1thermal wellmagnetotelluricseismicgravitymagneticstructuralblindresourcecharacterizationidahogeologyar-arbasalticvolcanovolcanic rockwell datathermalgeophysicssrpmtpfamodelingbostichydrologicwaterchemistrysurvey

Snake River Plain Geothermal Play Fairway Analysis Project Active Source Seismic Data

Sep 30, 2018
5.99 GB
Publicly accessible
This archive contains seismic shot field records for 10 profiles located in Camas Prairie, Idaho. The eight numbered .sgy files were acquired using a seismic land streamer system with an accelerated weight drop source and 72 geophones. These 10-Hz geophones were mounted on base pl...
Authors
Liberty, L. and Shervais, J. Boise State University
geothermalenergypfaplay fairway analysisidahosrpsnake river plainseismicactive sourcedatageophysicsmapsurveygeophysicalcamasprairiesgygeologytopographyaerialgeologictopographicfairfield

Eastern Great Basin Geothermal Play Fairway Analysis Report

Jun 01, 2017
111.23 MB
Publicly accessible
This is the final report for the second phase of geological, geophysical, and geochemical data collection and processing for the Eastern Great Basin Geothermal Play Fairway Analysis project.
Authors
Wannamaker, P. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutahplay fairway analysisplay fairwaygreat basineastern great basinfinal reportpfaresourceidentificationexplorationwesternutregionextensionvolcanismheatpermeabilityflowboreholemtmagnetotelluricsresistivityanomalygeochemistryfluidgasvolcaniceruptionfaultstresscriticallyseismicitygravitygeophysicsgeologictwin peaksrhyolite fieldseismicpassivenodalmappingheliumsurveyheprobability krigingcrater knolldrill holesitingcomposite riskphase 2geology

CIRES Approach Overview to Using Thermal Infrared Imagery to Find Geothermal Systems in Colorado

Feb 01, 2012
237.36 kB
Publicly accessible
Subsurface geothermal activity has a thermal expression that can be observed at the surface. Such spatial temperature gradients are within the radiometric resolution that is characteristic of a wide range of satellites that carry thermal sensors. For this effort, CIRES (part of ...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradociresasterlandsatremote sensingthermal infraredtarget areasgeothermal potentialidentifydeep resource wellspotential

Brady's Geothermal Field March 2016 Vibroseis SEG-Y Files and UTM Locations

Mar 31, 2016
982.28 GB
Publicly accessible
PoroTomo March 2016 Updated vibroseis source locations with UTM locations. Supersedes gdr.openei.org/submissions/824. Updated vibroseis source location data for Stages 1-4, PoroTomo March 2016. This revision includes source point locations in UTM format (meters) for all four Stage...
Authors
Feigl, K. University of Wisconsin
geothermalporotomovibroseisegsactive seismicsurveymetadatasweep datasource locationsutmactive sourcetruckgeophysicsgeophysicalsegyseismic datadasdasv

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Curated
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Curated
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Newberry FORGE: 3D Gravity Density Model for Newberry Volcano

Mar 11, 2016
46.3 kB
Publicly accessible
These data are Pacific Northwest National Lab inversions of an amalgamation of two surface gravity datasets: Davenport-Newberry gravity collected prior to 2012 stimulations and Zonge International gravity collected for the project "Novel use of 4D Monitoring Techniques to Improve...
Authors
Bonneville, A. Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemforgenewgengravitygravity inversiondensitynewberryoregonupper vertexgravity anomalygravity surveygeophysicsgeophysicalsusceptibilitymodelinverseinversion

Development of 3D Geological Model of Tuscarora Sandstone for Feasibility of Deep Direct-Use Geothermal at West Virginia University Main Campus

Oct 23, 2018
21.98 MB
Publicly accessible
The subsurface uncertainty at West Virginia University Main Campus is dominated by the uncertainty in the projections of geofluid flowrate in the target formation, the Tuscarora Sandstone. In this paper, three cores from the heterogeneous reservoir, available through West Virginia...
Authors
Moore, J. et al West Virginia University
geothermalenergydirect usecore analysispermeabilityddufeasibilitystudytuscarora sandstone3dgeologic modelgeologywvugrcpaperpresentationdataphotosthin sectionanalysisminipermeabilityclay-513preston-119deepreservoirparameter estimationgeofluidflow rate
<< Previous1234567Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service