OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 76 - 100 of 712.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"project summary"×

Sample Data from a Distributed Acoustic Sensing Experiment at Garner Valley, California

Sep 10, 2013
133.84 MB
Publicly accessible
In September 2013, an experiment using Distributed Acoustic Sensing (DAS) was conducted at Garner Valley, a test site of the University of California Santa Barbara (Lancelle et al., 2014). This submission includes one 45 kN shear shaker (called "large shaker" on the basemap) test ...
Authors
Lancelle, C. University of Wisconsin
geothermalporotomodasmapaccelerometergeophonegarner valleycaliforniadistributed acoustic sensingfiber-opticfiber opticsvibroseisposterproject summary

WHOLESCALE Catalog of Rock Samples at San Emidio Nevada collected in January 2021

Jan 12, 2021
857.7 MB
Publicly accessible
This submission contains information on thirty-six rock samples collected from San Emidio, Nevada during January, 2021 for Subtask 2.3 of the WHOLESCALE project. The following resources include a .zip of rock sample photos taken in the field, a .zip of rock sample photos taken in ...
Authors
Kleich, S. et al University of Wisconsin Madison
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalsan emidionevadarock samplesfieldsamplessamplerock samplegeologyimagesphotoscore samples

Life Cycle Water Consumption and Water Resource Assessment for Utility-Scale Geothermal Systems: An In-Depth Analysis of Historical and Forthcoming EGS Projects

Aug 31, 2013
10.97 MB
Publicly accessible
This report is the third in a series of reports sponsored by the U.S. Department of Energy Geothermal Technologies Program in which a range of water-related issues surrounding geothermal power production are evaluated. The first report made an initial attempt at quantifying the li...
Authors
Schroeder, J. et al Argonne National Laboratory
geothermalegswaterlife cyclewater consumptionpowerregional water resource assessmentstimulationinternationaldomesticgeologypermitnevadaproductioninjectioncaliforniaoregonoperationalabovegroundmake-upcoolingwellobservation wellnepadrillingproduction wellinjection wellchemicalflow testcirculation testexploration welllossreservoir lossbelowground lossoperational lossloss ratelife cycle assessmentwater resource

Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation

Jan 01, 2010
780.83 kB
Publicly accessible
Glass Buttes Exploration and Drilling: 2010 Geothermal Technologies Program Peer Review Presentation, Walsh, et al, Ormat
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermal alterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidar3d geologic modelpeer reviewfield workhyperspectralgravitymineral assemblages

Snake River Plain FORGE: Well Data for USGS-142

Nov 23, 2015
19.78 MB
Publicly accessible
Well data for the USGS-142 well located in eastern Snake River Plain, Idaho. This data collection includes lithology reports, borehole logs, and photos of rhyolite core samples. This collection of data has been assembled as part of the site characterization data used to develop ...
Authors
Twining, B. Idaho National Laboratory
geothermalforgeegscore sample photosrhyolitelithologysrgcsnake river plainidahotempaddendumboreholelogusgs 142core samplesphotospresentationxrf datawhole rocktrace-element analysisignimibritethin sectionpetrographicimagesnatural gammagamma radiationtemperature profileneutron porositygamma-gammadensitywell logsrpcore samplecore photosmineralogypetrographygeologystratigraphic columnstratigraphyxrfsrg

Low-Temperature Hydrothermal Resource Potential Estimate

Jun 30, 2016
2.79 MB
Publicly accessible
Compilation of data (spreadsheet and shapefiles) for several low-temperature resource types, including isolated springs and wells, delineated area convection systems, sedimentary basins and coastal plains sedimentary systems. For each system, we include estimates of the accessible...
Authors
Mullane, M. et al National Renewable Energy Laboratory
geothermalhydrothermallow-temperaturedirect usespringswellsdelineated areasedimentary basinaccessible resource basemean extractable resourcebeneficial heatusgsresource potentialcoastal plainslow temperatureegsdepthshallow temperauteconvectionconductioncoastal plainisolatednrelsmubottom-hole-temperaturetemperature datadepth dataisolated systemshapefilegis data

Cape EGS: Gold 6-IB: Mud Log, Mass Spectrometry, and Dipole Sonic-Derived Geomechanical Data

Apr 30, 2025
20.64 MB
Awaiting release
This dataset includes geological and geophysical well log data from the Gold 6-IB well at the Cape EGS site in Utah, collected between January and April 2025. The data span the full well depth from surface to total depth (15,054 feet) and encompass mud log information, mass spectr...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsgold 6-ibmud logmass spectrometrydipole sonicgeomechanicsutah forgeacoustic slownessporosityanisotropywell logsgas analysislaslithologyraw data

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Steel Pipe

Jul 23, 2019
1.24 MB
Publicly accessible
The steel pipe experiment conducted in the lab was using 6 meter low-carbon steel pipe. We tested it with both dry and in-water condition. In the dry experimental setup, a coaxial cable acting as a return path in the air.
Authors
Wang, J. and Wu, Y. Lawrence Berkeley National Laboratory
geothermalenergytdrtime domain reflectormeryegssystem analysisinnovative exploration technologieslab experimentlabwellborewellintegritycasinggeophysicssteelpipepipinglow-carbondrywetexperimentsensingassessmentwise-casing

Project HOTSPOT: Mountain Home Well Borehole Geophysics Database

Nov 11, 2012
209.37 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainproject hotspotidahoyellowstone hotspotborehole geophysicsmountain homegeophysicsborehole logdowhnhole geophysicstemperaturepressuregamma raymagnetic susceptibilitygeochemistrythoriumuraniumpotassiumneutronresistivityimage logsrpboreholewell data

Developing Successful Exploration Strategies in Extended Terranes

Dec 31, 2013
7.07 MB
Publicly accessible
We conducted a comprehensive analysis of the structural controls of geothermal systems within the Great Basin and adjacent regions. Our main objectives were to: 1) Produce a catalogue of favorable structural environments and models for geothermal systems. 2) Improve site-specifi...
Authors
E., J. University of Nevada
geothermalstructural controlsgreat basinquaternary faultswalker lanesouthern cascadespotential for developmentsubsurfacegeologykinematic analysisstress determinationgravitygravity surveygeophysicsgeophysicalslip tendancy3d modelingtectonic settingdrill sitedrill site selection

Seismic Survey 2016 Data at Crescent Valley, Nevada

Dec 04, 2023
469.57 GB
Publicly accessible
In September 2016, 989 vertical-component seismic instruments were deployed for 75 hours at the Crescent Valley greenfield geothermal play area in Nevada. Data were recorded 12/9/16 12/15/16. Data are stored in individual files in one-minute increments in SEGD formats. See the met...
Authors
Lord, N. et al University of Wisconsin Madison
geothermalenergywholescaleseismicdatageophysicscrescent valleyhydrothermalcharacterizationsegdsubterpermeabilitymappinggreenfieldnevadasp1fracturesurveygeophone

Dataset for report: Non-Technical Barriers to Geothermal Development in California and Nevada

Mar 10, 2022
66.68 MB
Publicly accessible
In California and Nevada, geothermal projects are subject to non-technical barriers, which may create development delays leading to higher project costs and risks and decreased competitiveness with other electricity generation technologies. These non-technical barriers may include...
Authors
Levine, A. et al National Renewable Energy Laboratory
geothermalenergycalifornianevadasalton searegulatorybarriersnon-technicalinterviewsenvironmentalstakeholdersnon-technical barriersntbgeoreportseatpermitenvironmental reviewauthorizationseconomiclcoecostfeasibilityprocessed dataannual technology baselineatbimperial countychurchill county

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

Testing LCM on a Large Scale for Geothermal Drilling Applications Using a Novel Experimental Setup

Apr 22, 2022
15.98 MB
Publicly accessible
Rheology data obtained from flow loop tests, performed using different lost circulation materials (LCM) to study their effect on fluid rheology and wellbore hydraulics. The sealing performance of different LCM was tested using different fracture sizes. Five academic papers / repor...
Authors
Mohamed, A. et al University of Oklahoma
geothermal drillinglost circulationsealing efficiencyrheologyhigh temperatureflow loop3d printingtemperaturecharacterizationdrilling fluid additivesshape memory polymergeothermal wellshpht challengesdrilling fluidwellbore hydraulicshole cleaningfluid stabilitysmart lcmht flow looplost circulation materialannular flowrheological propertiesgeothermalenergyviscosifierfiltration controlhphtgeochemistrywellboredrilling technologyexperimenttechnologyreportsgwmodeldrillingprocessed data

Ore Deposits Mined for Critical Elements

Jul 27, 2017
35.75 kB
Publicly accessible
Summary of deposit types containing critical elements, including, cobalt, gallium, germanium, indium, niobium, PGE, REE, rhenium, selenium, and tellurium. Includes information about ore deposit type, mineralogy, geologic setting, example deposits and districts, concentration range...
Authors
Verplanck, P. and Kelley, K. Energy and Geoscience Institute at the University of Utah
geothermalenergycritical elementsore depositsreerare earth elementsmininggeologymineralogyresourcegradecobaltgalliumgermaniumindiumniobiumpgeplatinum group elementsrheniumseleniumtelluriumcoproduced

Utah FORGE: Well 16B(78)-32 Canamera Core Drilling Report

May 17, 2024
5.61 MB
Publicly accessible
This is a summary report by Canamera Coring discussing the core drilling of Utah FORGE Well 16B(78)-32. This report includes detailed drilling graphics, images, and metrics from each coring run completed. About 240' of 4" core was taken from 4855' to 10493' in depth.
Authors
Mock, B. Canamera Coring
geothermalenergy16b16b coringutah forgecanamera coringcanamera16b core report16b78-3216b78-32 coring16b78-32 core reportegsgeologydrillinglogsbhajmstechnology

Utah FORGE 6-3712: Report on a Data Foundation for Real-Time Identification of Microseismic Events

Jan 21, 2025
971.63 kB
Publicly accessible
This submission is a technical report for the Probabilistic Estimation of Seismic Response Using Physics Informed Recurrent Neural Networks project. The report describes the process of extracting events from the borehole seismic sensors. To be effective once deployed, the process ...
Authors
Williams, J. et al Global Technology Connection, Inc.
geothermalenergyutah forgedata processingmachine learninginduced seismicitytechnical reportevent detectionmlartificial intelligenceaireal-timephysics informedrecurrent neural networksborehole seismicseismic datamicroseismicevent catalogmagnitude-frequency distributiongeophysicsegs

GeoDAWN: Airborne magnetic and radiometric surveys of the northwestern Great Basin, Nevada and California

Mar 01, 2024
Size unavailable
Publicly accessible
This submission encompasses the airborne magnetic and radiometric survey data from the northwestern Great Basin in Nevada and California, collected under the GeoDAWN initiative: Geoscience Data Acquisition for Western Nevada. Included in the dataset are all flight details, geophys...
Authors
Glen, J. and Earney, T. United States Geological Survey
geothermalenergygeodawnnevadacaliforniaremote sensingearthmriexplorationprocessed datamappingaerialmagneticradiometricgreat basinmineralusgsgeospatialgeologygeophysicsairbornesurface geologysoil compositionsubsurface structurehigh-resolution

PoroTomo Distributed Temperature Sensing (DTS) Measurements made in Brady Observation Well 56-1

Jan 09, 2019
105.8 MB
Publicly accessible
This submission is a follow-up to Distributed Temperature Sensing (DTS) measurements made in Brady observation well 56-1 during the PoroTomo field experiment conducted in March, 2016. The measurements in this data set were made on August 24, 2018 over an approximately 20 hour per...
Authors
Kratt, C. et al Oregon State University
geothermalenergydtsbradyporotomoctempsfiber opticsilixadistributed temperature sensingwell 56-1matlabdataporoelastic tomographybrady hot springsnevadanvobservation wellsilixa xt

Lab-Scale Stimulation Results on Surrogate Fused Silica Samples

Jul 06, 2016
73.74 kB
Publicly accessible
Lab-scale stimulation work on non-porous fused silica (similar mechanical properties to igneous rock) was performed using pure water, pure CO2 and water/CO2 mixtures to compare back to back fracturing performance of these fluids with PNNL's StimuFrac.
Authors
Fernandez, C. Pacific Northwest National Laboratory
geothermaleffective pressurefused silicastimufraclab-scale stimulationfracturing proformancehydraulic fracturingquartzfracking fluidpressuremeasured effective pressuresupercritical co2reservoir stimulationegs

Utah FORGE: Deep Wells Temperature Surveys as of September 2022

Sep 16, 2022
10.09 MB
Publicly accessible
This Excel spreadsheet contains temperature survey results for Utah FORGE wells 58-32, 78-32, 56-32, 16A(78)-32 and 78B-32. It also contains charts and comparisons, along with a "Data Summary" which provides links to previous GDR submissions with temperature data for each well.
Authors
Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeutah forge deep well temperaturesutah forge well temperaturesdeep well temperaturesforgeegstemperaturetemperature surveytemperature datacharacterizationdeepwellequilibratedrecoverycomparison

Simbol Materials Lithium Extraction Operating Data From Elmore and Featherstone Geothermal Plants

Jul 01, 2015
253.5 kB
Publicly accessible
The data provided in this upload is summary data from its Demonstration Plant operation at the geothermal power production plants in the Imperial Valley. The data provided is averaged data for the Elmore Plant and the Featherstone Plant. See average brine composition tab for submi...
Authors
Harrison, S. Simbol, Inc
geothermalsalton seaelmorefeatherstonelithiummineral extractionicp-oesbrine treatmentfetherstonesimbol materialsextractionimperial valleybrinebrine compositiondemonstrationchemistrywater chemistrygeochemistry

Ionic Fluids for EGS: Fracture Conductivity Tests in Granite Core Samples

Sep 13, 2025
162 MB
Publicly accessible
This dataset contains experimental measurements of fluid flow and pressure behavior during fracture conductivity tests in granite core samples. The tests were designed to evaluate various ionic and nonionic fluids, including BMiMBr, HPyBF4, HPyBr, an oil-based fluid (OBF-1), and a...
Authors
Momoh, I. and Lee, H. Oklahoma State University
geothermal fluidsfracture conductivityfractured graniteenhanced geothermal systemsegsionic fluids for egscore floodinggranite core testsinjection pressureflow ratetemperature-dependent behaviorionic-based fluidsgeochemistrylaboratory dataraw data

Western USA Assessment of High Value Materials in Geothermal Fluids and Produced Fluids

Oct 31, 2018
13.53 MB
Publicly accessible
This submission includes the following: Field Characteristics: Describes the geological and production field characteristics of sampling sites Geochemistry of Produced Fluids Idaho-Nevada-New Mexico-Oregon-Utah: Summarizes the all the analytical results for aqueous samples...
Authors
Simmons, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergygeologyproduction fieldsfluid geochemistrytrace elementsstable isotopeshelium isotopestrace element geochemistryrocksdrill cuttingscalcite scalesroosevelt hot springsdixie valleybeowawemineralogy-lithologymineral depositsdrillcuttingsmineralogynevadautahidahooregonnew mexicoproducedwaterfluidgeochemistryreservoirtrace elementmineraldepositgeologicalgeochemicalcoproducedcritical elements

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous
<< Previous12345678Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service