OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 38.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"Utah seismograph stations"×
Gravity×

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Maui Gravity and Soil Gas Surveys

Apr 01, 2010
1.37 MB
Publicly accessible
Contains a ground-based gravity survey of South Maui and a series of soil CO2 flux and temperature surveys encompassing Maui and the Big Island. The gravity survey was collected from approximately 284 km2 and consisted of 400 gravity stations with 400 m spacing. Locations were de...
Authors
Akerley, J. Ormat Nevada Inc
geothermalgravitymauigeophysicsbouger anomalysoil fluxgeochemistrysoil gastemperaturehawaiibig island

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Gravity Survey on the Glass Buttes Geothermal Exploration Project Lake County, Oregon

Oct 12, 2011
1.19 MB
Publicly accessible
This report covers data acquisition, instrumentation and processing of a gravity survey performed on the Glass Buttes Geothermal Exploration Project, located in Lake County, Oregon for ORMAT Technologies Inc. The survey was conducted during 21 June 2010 to 26 June 2010. The surve...
Authors
Akerley, J. Ormat Nevada Inc
geothermaloregonglass buttesgravitygeophysicsgravity surveygravity datalake countyhat buttepotato lakedatareportorgps datasafetyenvironmental issuesimpact

Fallon FORGE: Gravity and Magnetics Data

Mar 09, 2018
5.68 MB
Publicly accessible
This package contains principal facts for new gravity data collected September November 2017 in support of the Fallon FORGE project. Also included are rock core density and magnetic susceptibility data for key core intervals, used in modeling 2D and 3D gravity inversions. Indivi...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyforgeegsfallongravitynevadadensitymagnetic susceptibilityvetted-nonvmagneticsbch-3foh-2sw51-20bunejug mountains3dinversiongeophysicsgravmagrock densityinverse modelgeospatial datadata

Nevada Great Basin Play Fairway Analysis Regional Data

Oct 28, 2015
260.6 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalnevadaearthquakesquaternary faultsgeodetic straingravityfavorabilitypermeabilitywellsspringsstructurestransmission linesexplorationwildernessheatiso 240iso 267hgmgravity stationsstrain ratemt stationsquaternaryfaultsslip ratesummed slipdilation tendencyerrordirect evidenceinputmodeldegree of explorationmagnitudedepthlocationfairwaybenchmarks130ccombined permeabilityfaultbufferexploration opportunitiesanomalous valuespower plantsgreat basingeothermal systems3kmtemperature modelquaternary faultrecencystudyhorizontalgradient2.40g/ccphase 2second invarianthorizontal gravity gradientregional permeabilityearthquakedilation potentialslip ratesslip tendencysummed dilationfault namepowertransmission20kmtemperaturegeothermometerforest serviceblmusfsndotroadsmxdmaparcgismpkmap packagenv great basingeospatial datadataarc

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Lightning Dock Geothermal Field Data Package, Hidalgo County, New Mexico

Aug 19, 2026
7.4 GB
Publicly accessible
This submission is a curated geoscience, well and plant-operations data package for the Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico, a liquid-dominated system produced for binary (ORC) power generation. It covers well-by-well data...
Authors
Ifrene, G. et al Zanskar Geothermal
lightning dockwell logsgisproduction datageothermalenergytracer testpower generationgeochemistrygeophysicsgroundwaterbinary systemorcdownhole temperaturebouguermagnetotelluricinversion modelsaeromagneticsgravity surveylidarquaternary faultgeologymud logstemperature

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Gravity Survey of the Carson Sink Data and Maps

Dec 31, 2013
715.03 MB
Publicly accessible
A detailed gravity survey was carried out for the entire Carson Sink in western Nevada (Figure 1) through a subcontract to Zonge Engineering, Inc. The Carson Sink is a large composite basin containing three known, blind high-temperature geothermal systems (Fallon Airbase, Stillwat...
Authors
E., J. University of Nevada
geothermalcarson sinkbasin and rangegravity studygravity modeldepth to basementnevadagreat basindepth to basmentfallon airbasestillwatersoda lakegravity surveygeophysicscomplete bouger anomalybouger anomalydatageospatial data

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

Utah FORGE: Raw Microgravity Composite Data Updated 10/2021

Oct 01, 2021
7.98 kB
Publicly accessible
This is a microgravity dataset from the Utah FORGE site near Milford, Utah. This composite dataset was updated in October, 2021 and contains data from December 17th, 2018 through September 24th, 2021. The data includes the GPS location of the measurement, date of the measurement, ...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergygravity datamicrogravity datautah forgeutah forge microgravityutah forge gravityutah geothermalmigrogravitygravitydatageophysicsutahraw datagpsgravity station

Utah FORGE: UGS Interactive Geoscience Map

Jan 01, 2021
Size unavailable
Publicly accessible
This is a link to the Utah Geological Survey's Utah FORGE Interactive Geoscience Map. The map layers include information on geology, geography, subsurface temperatures, seismicity, gravity and groundwater. Instructions for using the interactive map and a legend for the interactive...
Authors
Hill, J. Utah Geological Survey
geothermalenergyutah forgeinteractive mapgeology mapgravity maptemperature mapseismicity mapgroundwater mapugs mapsutah geological survey mapsutah forge mapsmapgeologyseismiclstgroundwaterhydrologyugsutahforgeinteractivegravityprocessed datageospatial datawater table depthgroundwater chemistrywellfaultwell temperaturetemperaturebedrockbedrock surfacebeddingfoliationcontactgeographycharcterizationegsmilfordroosevelt hot springsenhance geothermal systemengineered geothermal system

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Utah FORGE: Composite Raw Gravity Data 2021

Jun 04, 2021
7.3 kB
Publicly accessible
This is a composite raw gravity dataset of the Utah FORGE area taken over time from December 2018 to to June 2021. The data shows differences in local gravity at different location across Utah FORGE. Included with the gravity data is the NAD83 UTM coordinates of each station in me...
Authors
Hardwick, C. Utah Geological Survey
geothermalenergyutah forgeutah forge gravity 2021forge gravity 2021gravity dataraw gravity dataraw datadatautahforgegravitygeophysicsgeophysicalgravimeter

Geothermal Exploration Raster Files for Utah Play Fairway Analysis

Jun 16, 2017
1.19 MB
Publicly accessible
This submission contains raster files associated with several datasets that include earthquake density, Na/K geothermometers, fault density, heat flow, and gravity. Integrated together using spatial modeler tools in ArcGIS, these files can be used for play fairway analysis in rega...
Authors
Wannamaker, P. Energy and Geoscience Institute at the University of Utah
geothermalenergyexplorationplay fairway analysisgravityheatearthquakefaultgeothermometerutahsevierpfawesternrasterheat flowfault systemsspatialgeospatialeasterngreat basineastern great basingeospatial datageophysicscharacterization

Utah FORGE: Phase 2C Topical Report

Dec 11, 2019
147.81 MB
Publicly accessible
This is the topical report that wraps up the work and results achieved during Utah FORGE Phase 2C. The zip file includes several folders containing (1) an overview; (2) the results; (3) the lessons learned; and (4) the conclusions. It also contains a folder containing appendices i...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeutah forge phase 2c reportphase 2c topical reportutah forge phase 2cegsmoderate rate injection testsmicroseismicdistributed acoustic sensingdasseismic reflection surveygravity measurementsinsarstimulatednumerical reservoir modelsalluvium-granitoidinjection testingmilfordroosevelt hot springsoverviewresultslessonslearnedconclusionspermittingcharacterizationsitedata inventoryconceptualgeologicmodelgeophysicsseismicgravitygeologyfeasibilitytechnicalinjection testmicroseismicityremote sensingmodelingstimulation

Gravity Data from Cove Fort and Dog Valley, Utah Play Fairway Analysis

Aug 27, 2018
66.37 kB
Publicly accessible
This is a zipped archive containing an ArcGIS shapefile and a text file containing gravity data covering the Cove Fort and Dog Valley areas in central Utah. Part of the data was acquired by the Utah Geological Survey and part came from PACES (University of Texas El Paso). The attr...
Authors
Nash, G. and Hardwick, C. Energy and Geoscience Institute at the University of Utah
geothermalenergygravity datagravityutah play fairwayplay fairwaycove fort gravitydog valley gravitycomplete bouguer gravitygeothermal play fairwayplay fairway analysisutahutgeophysicsgeophysical datacompletearcgisgeospatial datagisshapefilebougueranomalycove fortdog valleyfree airterraincorrectioncorrectedpfadataeastern great basin

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Utah FORGE: 3D Gravity Data

Jun 24, 2019
11.24 MB
Publicly accessible
These resources describe the 3D geophysical inversion modeling of gravity data at the FORGE site near Milford, Utah. FORGE is the Frontier Observatory for Research in Geothermal Energy and the site in Utah has been selected by the U.S. Dept. of Energy for a 5-year R&D program to t...
Authors
Hardwick, C. and Witter, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge3d gravity datagravity datautah forge gravity datautah geothermalcomplete bouguerdensity modelgravityterrestrial gravity surveyobserved gravityforgegeophysics3d3d model3d gravitygravity anomalyegsmilfordinversionmodellinginverseroosevelt hot springsbougertop of granitedensitysurveysimple bougerfree airterrain correctiongeologiccorrectioncorrectedutahmodelmodeling

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Curated
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. shp and tif files are zipped with all applicable sideca...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service