OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 10 of 10.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"bottom"×
Drilling and Completion×

Sedimentary Geothermal Feasibility in Nevada, Western Utah, Colorado, and the Gulf Coast Region of Texas Final Report

Jul 01, 2020
Size unavailable
Publicly accessible
The objectives of this project were to (1) perform a literature review of sedimentary geothermal resources, (2) identify data sources and develop data-collection methodologies that characterize selected resources, (3) screen sedimentary basins and formations for sedimentary geothe...
Authors
Johnston, H. et al National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitysedimentary basinelko basinrailroad valleysteptoe valleypavant buttedenver basinpiceance basinraton basingulf coast regionnevadautahtexasgbcaasgreat basin carbonate and alluvial aquifer systemcarbonateagsadvanced geothermal systembottom-hole temperaturewell datalcoeeconomicsupperlowercarbonate aquifer unitegsenhanced geothermal systemplay fairway analysiscoloradotemperaturebottom-holemarys river basindrillingpermeabilityreservoirmodelingcarbonate geothermal systemcgstechno-economicanalysisdownselectsubsurfacedata mininggeologygradientheatflowgeophysicsseismicclosed-loophydrogeologycoststructuralbedrockmapaquifersedgeo

Practices Maintain Straight Hole in Crooked Hole Conditions, While Also Enabling Significant Gains in Drill Rate

Apr 30, 2014
Size unavailable
Publicly accessible
Bottom hole assembly (BHA) designs were assessed in field trials for their ability to achieve critical low inclination requirements, while simultaneously enabling high drill rates. Because angle has historically been controlled by reducing weight on bit (WOB), these are often com...
Authors
Knudsen, S. et al Sandia National Laboratories
geothermalbhadrillingpacked bhapendulum bhamsemcginness hills fieldwobbottom hole assemblyweight on bitmechanical specific energyspeinclinationanglemcginness hills

Geothermal Exploration of Newberry Volcano, Oregon Summary Report

Jan 01, 2015
64.62 MB
Publicly accessible
Abstract: Davenport Newberry (Davenport) has completed 8 years of exploration for geothermal energy on Newberry Volcano in central Oregon. Two deep exploration test wells were drilled by Davenport on the west flank of the volcano, one intersected a hydrothermal system; the other ...
Authors
Waibel, A. et al Southern Methodist University
geothermalnewberrynewberry volcanodavenportaltarockexplorationdrillinginvestigationsitestructuralblind geothermal systemvolcanicterrainoregoniet

Utah FORGE: Well 82-33 Logs and Data, Roosevelt Hot Spring Area

Mar 03, 2016
74.2 MB
Publicly accessible
This is a compilation of logs and data from Well 82-33 in the Roosevelt Hot Springs area in Utah. This well is also in the Utah FORGE study area. The file is in a compressed .zip format and there is a data inventory table (Excel spreadsheet) in the root folder that is a guide to t...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgeegsutah forgeutah egsroosevelt hot springgeothermal well logswell logsutah well logsgeothermal wellsutah geothermal wellsroosevel hot springbottom hole pressurecasing schematiccleanoutsdirctional surveygeochemistrygeology loginjection cpaacitymorning reportsplan of operationsspinner surveyinjection testwater analysiswater chemistrycompensated soniccalipercement bondcollar logcompensated neutronformation densitydifferential temperaturegamma raymud loginductionpressure surveytemperature surveywell logwell data82-33utahresourcecharacterizationmilfordroosevelt hot springs

Utah FORGE: Deep Well 58-32 (MU-ESW1) Core Data

Apr 11, 2018
6.34 GB
Publicly accessible
These datasets, images, and graphics were derived from core drilling and core that was extracted from Utah Forge deep well 58-32 (originally called MU-ESW1), near Roosevelt Hot Springs.
Authors
Nash, G. and Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeforgeroosevelt hot springsutahwell 58-3258-32core datacore imagesct scanscomputerized axial tomographycat scanscore samplesphotosvideosslicesraw imagesdrilling parametersbottom hole assemblycoring datacoring logcoredatadrillingmu-esw1well dataresourcecharacterizationegsmilforddeep well

WISE-CASING: Time Domain Reflectometry Data from Cymric Field, CA

Feb 21, 2019
2.5 MB
Publicly accessible
The objective of this field test is to validate several technologies for non-invasive well integrity assessment using existing wells with a known completion. The tests were made at the Cymric oil field, which is a steam flood operation. The wells therefore undergo similar downhole...
Authors
Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrfield testsyclic steamwellsgeophysicstime domain reflectormetryinput pulse frequencywellwellborecasingintegritywise-casingcymricfieldoilsteam floodemelectromagneticdatakern countyhigh frequencycorrosionboreholeexperimentsensingassessment

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service