OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 36.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"digital elevation map"×
Gravity×

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

Steptoe Valley NV Data Compilation: Understanding a Stratigraphic Hydrothermal Resource through Geophysical Imaging

Nov 01, 2023
1.43 GB
Publicly accessible
Sandia National Laboratories partnered with a multi-disciplinary group of subject matter experts to evaluate a stratigraphic geothermal resource in Steptoe Valley, Nevada using both established and novel geophysical imaging techniques. Provided here are a compilation of newly acqu...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergynevadasteptoe valley3d geological modelmtgeochemistryhydrothermalstratigraphygeophysicsmagnetotelluricscsemelectromagneticsgravitygeologymodelingreflectionseismicleapfrogseismic reflectionwater sampleprocessed dataraw datacontrolled-source electromagneticleapfrog energyfeasibilityaqueous

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Basin and Range Investigation for Developing Geothermal Energy: Exploration Data

Jan 03, 2022
266.32 GB
Publicly accessible
This data package includes exploration material from the Basin & Range Investigation for Developing Geothermal Energy [in Hidden Systems] project (BRIDGE), which is part of a broader initiative to advance the exploration of hidden geothermal resources in the Basin & Range Province...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergybasinrangeexplorationpotential fieldsairborne electromagneticsmagnetotellurics2-metertemperatureinversionconceptual modelnevadadixie valleyhawthornegabbs valleywalker lanegeologic mappinglidar analysisgeochemistrygravitylee allengrover pointhiddenblindclay caphidden systemsblind systemsgeophysicsraw dataprocessed data

Lightning Dock Geothermal Field Data Package, Hidalgo County, New Mexico

Aug 19, 2026
7.4 GB
Publicly accessible
This submission is a curated geoscience, well and plant-operations data package for the Lightning Dock geothermal field in the Animas Valley, Hidalgo County, south-western New Mexico, a liquid-dominated system produced for binary (ORC) power generation. It covers well-by-well data...
Authors
Ifrene, G. et al Zanskar Geothermal
lightning dockwell logsgisproduction datageothermalenergytracer testpower generationgeochemistrygeophysicsgroundwaterbinary systemorcdownhole temperaturebouguermagnetotelluricinversion modelsaeromagneticsgravity surveylidarquaternary faultgeologymud logstemperature

Snake River Plain FORGE: Site Characterization Data

Apr 18, 2016
632.32 MB
Publicly accessible
The site characterization data used to develop the conceptual geologic model for the Snake River Plain site in Idaho, as part of phase 1 of the Frontier Observatory for Research in Geothermal Energy (FORGE) initiative. This collection includes data on seismic events, groundwater,...
Authors
Moos, D. and Barton, C. Idaho National Laboratory
geothermalforgeegssrgcsnake river plainidahosite characterizationsite datageologic modelgeomechanical modelwell datatempsupplementaladdendum3d modelrock physicsinel-1wo-2usgs-142websiteeventsinformationblogdatacollectionpaperstressinel sitestrian ratesdeformationanalyticalmodelinlseismicmonitoringannual reportmapseismic modelinggeologichistorysettingsublithosphericneogeneyellowstoneheisepicabovolcanicfieldvoncanicgravityheat flowcalderavolcanismmantle plumeoceanic hotspotmagmatismgrraesrpeastern snake river plainbasinpotentialsiteextensionsubsidencepaleoseismologyextensional structuresintrusiontectonic faultsgeomechanicalcharacterizationheheliumisotopeisotopic evidenceundiscoveredgeothermal systemserspaquiferthermal watermodelingthermalgeochemicalanomaliesconceptual modelwellboregroundwatertemperaturedistributionwell headstdtarget depthlocationcoordinateselevationresidualisostaticmagneticusgsmagneticsnrmeasternmtinversionlong-periodphase 1resistivityelectricalsoundinggeoelectricsectionrefraction surveyteleseismicreceiverprofilingrefractionray trace3dvolcanicspaleozoicrhyoliticpetreljewelsuitefold hingessnapshotsrpsrgmagnetotellurics

Newberry Combined Gravity 2016

Jan 22, 2016
281.27 kB
Publicly accessible
Newberry combined gravity from Zonge Int'l, processed for the EGS stimulation project at well 55-29. Includes data from both Davenport 2006 collection and for OSU/4D EGS monitoring 2012 collection. Locations are NAD83, UTM Zone 10 North, meters. Elevation is NAVD88. Gravity in ...
Authors
Rose, K. National Energy Technology Laboratory
geothermalenhanced geothermal systemegsnewgennewberryoregongravitygeophysicsbougueranomaly

Lightning Dock Geothermal Field GIS Data

Aug 19, 2026
1.34 GB
Publicly accessible
This submission houses geospatial data for the Lightning Dock geothermal (LDG) field in the Animas Valley, Hidalgo County, south-western New Mexico. LDG is a liquid-dominated system produced for binary (ORC) power generation. For the full project description and data please see th...
Authors
Ifrene, G. et al Zanskar Geothermal
geothermalenergygeospatiallightning dockgiswaterchemistrywell datageologicaltemperaturegeophysicalaeromagneticgravitylidarfaults

Utah FORGE: UGS Interactive Geoscience Map

Jan 01, 2021
Size unavailable
Publicly accessible
This is a link to the Utah Geological Survey's Utah FORGE Interactive Geoscience Map. The map layers include information on geology, geography, subsurface temperatures, seismicity, gravity and groundwater. Instructions for using the interactive map and a legend for the interactive...
Authors
Hill, J. Utah Geological Survey
geothermalenergyutah forgeinteractive mapgeology mapgravity maptemperature mapseismicity mapgroundwater mapugs mapsutah geological survey mapsutah forge mapsmapgeologyseismiclstgroundwaterhydrologyugsutahforgeinteractivegravityprocessed datageospatial datawater table depthgroundwater chemistrywellfaultwell temperaturetemperaturebedrockbedrock surfacebeddingfoliationcontactgeographycharcterizationegsmilfordroosevelt hot springsenhance geothermal systemengineered geothermal system

Hot Pot: Complete Bouguer Gravity Map

Jun 28, 2013
88.7 kB
Publicly accessible
Contoured Bouguer gravity survey with lease block outline in 2010 and location of hot springs.
Authors
Lane, M. Oski Energy LLC
geothermalnevadahot potgeophysicsgravity surveymetadatabouger anomalygravity mapmap packagegisgeospatial data

LiDAR as an Exploration Tool

Jan 01, 2011
4.36 MB
Publicly accessible
Using LiDAR to identify structural and volcanic evolution of a Miocene-Pleistocene age bimodal volcanic complex and implications for geothermal potential. The file includes an updated geologic map, methods, and preliminary results.
Authors
Boschmann, D. et al Ormat Nevada Inc
geothermalglass buttesoregonstructural modelgravitybougerdemmagnetotelluricaeromagneticcolumbia plateaulidarhyperspectralinversionlineamentexplorationgeologic mapgeology

Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross Section

Nov 15, 2015
25.77 MB
Publicly accessible
This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. ...
Authors
Brandt, A. University of Utah
geothermalnew mexicotularosa basinmcgregor rangeschematicconceptual3dmodelfort blissxrdx ray diffractiontularosagammatemperature56-5centurycross sectionmapfaultstpprofilewellsmcgregorwell loglithologymineralogyfracturepitsurveyshallowdrill logstemperature surveydavis domefor blissrmi 56-5porosityresistivityspatialdepthfaultgoethermaltemperature profileohdrill logstratigraphygeologygasescdlcnldilcaliperdownholecross-sectionwell positionwell depthsurface mapwell locationgravitygeophysicsgeopysicalgeotechwell databoreholegeospatial dataarcgisshapefileshape filegis

Great Basin NV Play Fairway Analysis Carson Sink

Oct 28, 2015
182.99 MB
Publicly accessible
All datasets and products specific to the Carson Sink Basin. Includes a packed ArcMap (.mpk), individually zipped shapefiles, and a file geodatabase for the Carson Sink area; a GeoSoft Oasis montaj project containing GM-SYS 2D gravity profiles along the trace of our seismic reflec...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalgreat basincarson sinkarcmapseismic reflectionseismic linesgravitywell databasin3d modelnevadapfaarcmap projectoasis gm-sys gravity profilesshapefilereflection seismicgravity profilesgeodatabasegeologylinksspreadsheetmapsshapeifilewell collarnv great basin

Utah FORGE: Milford Gravity Data Shapefile

Mar 13, 2016
152.13 kB
Publicly accessible
This is a zipped GIS compatible shapefile of gravity data points used in the Milford, Utah FORGE project as of March 21st, 2016. The shapefile is native to ArcGIS, but can be used with many GIS software packages. Additionally, there is a .dbf (dBase) file that contains the dataset...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalutah forgeforgegravitygis dataegsutah egsroosevelt hot springsgisshapefileshape filegeospatial datacomplete bougergravity anomalygeophysicsgeophysical datagravity datautahmilfordcorrected datacomplete bouger anomalybouger anomalyfree airterraincorrectioncorrectedprocessed data

Fallon FORGE: GIS and Downhole Well Lithology Data

Dec 23, 2015
21.31 MB
Publicly accessible
ArcGIS Map Package with MT Station Locations, 2D Seismic Lines, Well data, Known Regional Hydrothermal Systems, Regional Historic Earthquake Seismicity, Regional Temperature Gradient Data, Regional Heat Flow Data, Regional Radiogenic Heat Production, Local Geology, Land Status, Cu...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsforgefallonnevadamesozoiclithologydown-holewell datagisgeophysicsgeologymap packagedownholeheat flowsite characteristicsgeospatial datamtmagnetotellurics2dseismiclinesstationlocationhydrothermalearthquakeseismicityhistoricaltemperaturegradienttemperature gradientradiogenic heatland statuscultural datatemperature probegravity

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Nevada Play Fairway Crescent Valley Geodatabase and Modeling Data

Aug 25, 2018
437.17 MB
Publicly accessible
This package contains data and metadata for 2-meter temperature probe survey, gravity, slip dilation, XRD analyses, play fairway modeling, and ArcGIS geodatabase resources. This project focused on defining geothermal play fairways and development of a detailed geothermal potentia...
Authors
Faulds, J. Nevada Bureau of Mines and Geology
geothermalenergynevadaplay fairwaytemperaturegravityxrdgeophysicsgisgeospatial datageodatabasearcgisshapefileslipdilationcrescent valleynvwell datamappfaprobe surveymodelingnv great basin

Gravity Survey of the Carson Sink Data and Maps

Dec 31, 2013
715.03 MB
Publicly accessible
A detailed gravity survey was carried out for the entire Carson Sink in western Nevada (Figure 1) through a subcontract to Zonge Engineering, Inc. The Carson Sink is a large composite basin containing three known, blind high-temperature geothermal systems (Fallon Airbase, Stillwat...
Authors
E., J. University of Nevada
geothermalcarson sinkbasin and rangegravity studygravity modeldepth to basementnevadagreat basindepth to basmentfallon airbasestillwatersoda lakegravity surveygeophysicscomplete bouger anomalybouger anomalydatageospatial data

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

Nevada Great Basin Play Fairway Analysis Reports & Appendices

Oct 28, 2015
52.81 MB
Publicly accessible
This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. ...
Authors
Faulds, J. et al Nevada Bureau of Mines and Geology
geothermalnevadaplay fairwayreportappendicesgreat basinnbmgnvpfacarson sinksteptoe valleygeophysicsgeophysicalgeologygeologiclidargeochemicalgravityseismic reflectionmtmagnetotelluricsgeodeticgeodesyshallow temperaturesoil gasslip and dilation tendancy3d modelingthermal modelingexplorationresource assessmentresource potentialinvestigationsurveypreliminarysite assessmentfavorabilitynv great basin

Tularosa Basin Play Fairway Analysis: Temperature, Geochemistry, and Gravity Data

Jun 16, 2017
4.22 MB
Publicly accessible
This submission contains multiple excel spreadsheets and associated written reports. The datasets area are representative of shallow temperature, geochemistry, and other well logging observations made across WSMR (white sands missile range); located to the west of the Tularosa Bas...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergygravitygeochemistrytemperaturewsmrtularosaexplorationplay fairway analysisnew mexicowell logginggeophysicsdownholeboreholeshapefileshape filearcgisgisgeospatialgeospatial datapfa
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service