OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 186.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"induced seismicity"×

Utah FORGE: 2023 Induced Seismicity Mitigation Plan

Aug 09, 2023
7.97 MB
Publicly accessible
This is the updated Utah FORGE Phase 3B induced seismicity mitigation plan (ISMP) covering the general Utah FORGE area. This new version incorporates newly collected seismic data, including data collected during the 2022 stimulation and a probabilistic seismic hazard assessment (...
Authors
Pankow, K. et al University of Utah Seismograph Stations
geothermalenergyutah forgeseismic mitigation planseismic mitigationseismicityseismicseismic hazardsearthquakesinduced seismicitygeophysicsfaultsoutreachriskhazardegsseismic monitoringseismic hazard assesment

Utah FORGE: Induced Seismicity Mitigation Plan

Dec 30, 2020
13.29 MB
Publicly accessible
This is the current induced seismicity mitigation plan (ISMP) for the Utah FORGE project. Information that was collected during Phases 1 and 2 of the Utah FORGE project has been incorporated, as have literature searches and risk assessments. The purpose of this report is to identi...
Authors
Utah, U. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyseismicityinduced seismicityseismicity mitigationutah forgeinduced seismicity mitigation planearthquakesseismicrisk mitigationriskhazardmitigationearthquakeutahmitigation planplangeophysicsegsfaultfaults

Utah FORGE 6-3712: Report on Building a Recurrent Neural Network Framework for Induced Seismicity October, 2025

Oct 13, 2025
1.62 MB
Curated
This is a technical report for the Probabilistic Estimation of Seismic Response Using Physics Informed Recurrent Neural Networks project. The report describes the process of designing a recurrent neural network (RNN) to predict induced seismicity. Background material is included t...
Authors
Williams, J. et al Global Technology Connection, Inc.
geothermalenergydeep learninginduced seismicitypredictivemagnitudeartificial intelligenceaimachine learningmldlphysics-basedmodelingutah forgeegstechnical reportseismic datainjection parametersgeophysical modelsprobabilistic

Penn State Lab Testing Fluid-Rock Interaction in Geothermal Reservoirs

Jan 01, 2018
5.53 GB
Publicly accessible
This project focused on assessment and discovery of fluid-rock interaction in geothermal reservoirs. We accomplished work in four main areas: 1) fracture formation and the relationship between fluid flow and shear failure, 2) assessment of fracture geometry and fluid permeability ...
Authors
Madara, B. et al Pennsylvania State University
geothermalenergylab testingfracture formationshear failurefluid flowfracture geometryfluid permeabilityacoustic measurementsinjectionseismicitytriaxial experimentsdynamic stressingreservoir permeabilityfracture flowpermeability evolutionacoustic fracture characterizationfrictional stabilitydynamic triggeringinjection induced seismicityinduced seismicityshear slipshear flowberea sandstonewesterly graniteegsacoustic emissionslab earthquakes

Newberry EGS Demonstration: Initial Project Report and Induced Seismicity Mitigation Plan, 2011

May 05, 2024
70.06 MB
Publicly accessible
This is the first project report and induced seismicity mitigation plan for the Newberry Enhanced Geothermal Systems (EGS) Demonstration project. The primary objectives of this first phase were to obtain necessary permits and comply with all regulations, including NEPA, communica...
Authors
Cladouhos, T. et al AltaRock Energy Inc
geothermalenergynewberryegsdemonstrationvolcanoaltarockoregongeologygeologic modelconceptual resource modelseismicityinduced seismicitymitigationmaximum magnitudein situ stresspermittingstimulationreservoir characterizationdrilling planwell testingrisk mitigationreporting

Utah FORGE 5-2419: Final Report and Presentation on Seismicity Permeability Relationships Probed via Nonlinear Acoustic Imaging

Sep 30, 2025
254.88 MB
Curated
This submission contains the final technical report and closeout presentation for Utah FORGE Project 5-2419, which investigates the coupled evolution of permeability and induced seismicity in enhanced geothermal systems using laboratory experiments, field observations, and nonline...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegspermeabilityinduced seismicitylaboratory experimentsfield observationsnonlinear acoustic imagingfault reactivationreservoir rockmicroearthquakestimulationphysics informed modelingmachine learningseismic momentstress statepermeability creationseismic hazardtechnical reportgeomechanicsgeophysicsmicroseismicity

GEISER Project The Geysers Seismic Broadband Data 2012 2013

Oct 31, 2018
Size unavailable
Publicly accessible
This link points to the Northern California Earthquake Data Center (NCEDC) to access The Geysers seismic broadband data. The two available data sets consist of continuous waveform data recorded at The Geysers from July 2012 to July 2013 and a processed catalog with earthquake info...
Authors
Gritto, R. Array Information Technology
geothermalenergyseismic broadband dataseismicmicroseismiccontinuousinducedseismicitymicroseismicitymonitoringeventnetworkegsgeyserscacaliforniaarrivalearthquakegeisergeothermal engineering integrating mitigation of induced seismicity in reservoirsmitigationreservoirsstimulationresourcedevelopmenthydraulic

kISMET Final Report and Highlights

Oct 31, 2016
10 MB
Publicly accessible
The files in this submission describes the results of a series of stress measurement and hydraulic fracturing experiments conducted at the Sanford Underground Research Facility (SURF) in Lead, SD. This report describes the accomplishments of the kISMET (permeability (k) and Induce...
Authors
Oldenburg, C. et al Lawrence Berkeley National Laboratory
geothermalenergystressegshydraulic fracturingnumerical modelingsanford underground research facilitycorepoorman formationanalytical modelingsubterhydraulic stimulationkismetpermeabilityinduced seismicitymanagementsurfborehole

Utah FORGE: Seismic Activity from April, 2019

May 01, 2019
2.12 kB
Publicly accessible
This dataset contains seismic event detections acquired using the 151 Nodal geophones deployed at the Utah FORGE site in April 2019. Details regarding the publishing are available in the paper linked below (Mesimeri, M. and K. L. Pankow et al. 2020). A frequency-domain-based algor...
Authors
Pankow, K. University of Utah Seismograph Stations
geothermalenergyutah forgeutah forge seismicseismic eventsutah seismic eventsegsmicroseismicitygeospatial datainduced seismicityseismic monitoringsurfacearraygeophysicsseismic

Utah FORGE 6-3712: Probabilistic Estimation of Seismic Response Using Physics-Informed Recurrent Neural Networks 2024 Annual Workshop Presentation

Sep 17, 2024
52.7 MB
Publicly accessible
This is a presentation on the Probabilistic Estimation of Seismic Response Using Physics-Informed Recurrent Neural Networks by GTC Analytics, presented by Jesse Williams. This video slide presentation discusses the development of machine learning-based predictive tools to estimate...
Authors
Williams, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemachine learningmulti frequencystimulation-induced seismicityseismicityseismicity predictorstimulationpredictive systemsdeep learningdlmagnitude-frequency distributionseismicegsvideopresentation

Utah FORGE: Laboratory Fault Reactivation and Permeability Evolution During Fluid Injection

Sep 15, 2025
182.35 GB
Curated
This dataset contains results from controlled shear reactivation experiments performed on cylindrical Westerly and granitoid granite samples with a single inclined fracture. Laboratory faults were pre-loaded near failure and reactivated by fluid injection to examine relationships ...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergyinduced seismicityutah forgewesterly granitegranitoidpermeabilityshear stimulationegsfault reactivationfluid injectionpermeability evolutionseismicityacoustic emissionssingle inclined fractureshear stresspore pressuretriaxial testingmechanical datageomechanicsraw dataprocessed dataacoustic data

Utah FORGE 6-3656: Real-Time Traffic Light System and Reservoir Engineering with Seismicity Forecasting and Ground Motion Prediction 2025 Workshop Presentation

Sep 18, 2025
86.94 MB
Curated
This is a presentation on Real-Time Robust Adaptive Traffic Light System and Reservoir Engineering with Machine-Learning-Based Seismicity Forecasting and Data-Driven Ground Motion Prediction (RT Forecast) by Lawrence Berkeley National Laboratory, presented by Nori Nakata. This vid...
Authors
Nakata, N. Lawrence Berkeley National Laboratory
geothermalenergyutah forge2025 annual workshopegsinduced seismicitytraffic light systemmachine learningseismicityforecastingground motion predictiongenerative aireservoir engineeringhigh-pressure experimentspresentationpresentation slidespresentation recordingreport

Microearthquake Studies at the Salton Sea Geothermal Field

Oct 01, 2013
409.48 kB
Publicly accessible
The objective of this project is to detect and locate microearthquakes to aid in the characterization of reservoir fracture networks. Accurate identification and mapping of the large numbers of microearthquakes induced in EGS is one technique that provides diagnostic information w...
Authors
Templeton, D. Lawrence Livermore National Laboratory
geothermalseismicityearthquakesmicroearthquakesinduced seismicityfractureseismologysalton sea

Brady's Geothermal Field Seismic Network Metadata

Dec 21, 2014
38.38 kB
Publicly accessible
Brady's geothermal field seismic network station locations and dates of operation.
Authors
Foxall, W. University of Wisconsin
geothermalegs microearthquake monitoringbrady egs seismic monitoring networkmetadataseismic networkseismic monitoringbradyegsporotomoseismicitymicroseismicitymeqinduced seismicitybradys geothermal fieldbradys hot springsearthquake

Active Source Seismic (Ultrasonic) Data from Double-Direct Shear Lab Experiments

May 05, 2021
Size unavailable
Publicly accessible
Active source ultrasonic data from lab experiments p5270 and p5271 including raw waveforms (WF) and mechanical data (mat). From the PSU team working on the "Machine Learning Approaches to Predicting Induced Seismicity and Imaging Geothermal Reservoir Properties" project. The fric...
Authors
Marone, C. Pennsylvania State University
geothermalenergyseismicactive sourcelaboratoryfriction experimentultrasonicgeophysicsmicroseismicitylab dataraw datawaveformsmechanical datapreprocessedmatlabacousticsacousticbiaxial testing apparatusultrasonic acoustic monitoring systemmachine learningdeep learningaiartificial intelligenceseismic forecastingearthquake forecastingfault

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Utah FORGE 6-3712: Probabilistic Estimation of Seismic Response Using Physics-Informed Recurrent Neural Networks 2025 Workshop Presentation

Sep 18, 2025
70.48 MB
Curated
This is a presentation on the Probabilistic Estimation of Seismic Response Using Physics-Informed Recurrent Neural Networks by GTC Analytics, presented by Dr. Jesse Williams. This video slide presentation discusses the development of machine learning-based predictive tools to esti...
Authors
Williams, J. GTC Analytics
geothermalenergyutah forgeegs2025 annual workshopinduced seismicitymachine learningrecurrent neural networksprobabilistic modelingseismic response predictionmagnitude-frequency analysisphysics-informed aipresentationpresentation recordingpresentation slidesreport

Newberry EGS Demonstration: Stimulating the Existing Fracture Network Report

Mar 10, 2014
10.4 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 3 year project started in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ...
Authors
Cladouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringnewgendemonstrationstimulationhydraulic

Utah FORGE 2-2404: Determination of Reservoir-Scale Stress State Presentation Slides

Jul 31, 2022
4.56 MB
Publicly accessible
This PowerPoint summarizes the integration of multiple approaches and data to constrain wellbore stress models at Utah FORGE. This stress determination used faulting theory, breakouts, and drilling-induced cracks detected in image logs. Wellbore stress profiles were established f...
Authors
Ghassemi, A. et al The University of Oklahoma
geothermalenergyfracture mechanicsfocal mechanismanelastic strain recoverydfitwellborestress characterizationstress modelin-situ stresspresentationslidesinduced seismicityreservoir stressutah forgeegsimage logsfaulting theorybreakoutsdrilling-induced cracks

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Utah FORGE 6-3712: Curated and Fused 2022 and 2024 Stimulation Injection Datasets and Processing Report February 2026

Feb 25, 2026
155 MB
Curated
This submission contains curated injection parameter datasets from the 2022 and 2024 stimulation experiments conducted at the Utah FORGE site, along with the report documenting the data processing workflow. The datasets were developed as part of Project 6-3712: Probabilistic Estim...
Authors
Williams, J. et al Global Technology Connection, Inc.
geothermalenergyinduced seismicityinjection parametersdatasetstimulationutah forgeegsstimulation experimentinjection datatreating pressureslurry rateclean ratecumulative injected volumeinflow rateflowbacktime-series dataprocessed datahydraulic stimulationfeomechanics

Utah FORGE 4-2541: Final Report and Presentation on Optimization and Validation of a Plug and Perf Stimulation Treatment Design

Jul 15, 2025
219.13 MB
Curated
This dataset contains the final technical report and closeout presentation for Utah FORGE Project 4-2541, which focused on the optimization and validation of a multistage plug and perf stimulation treatment design for enhanced geothermal systems. The report documents drilling, com...
Authors
Norbeck, J. Fervo Energy
geothermalenergyplug and perfstimulationutah forgeegshorizontal drillingmonitoring wellfiber-optic monitoringdistributed acoustic sensingdasdistributed temperature sensingdtspressuretemperaturestimulation performanceflow allocationfracture geometryinjectivityinduced seismicitytechnical reporthydraulic stimulation

Utah FORGE 5-2428: Fracture Permeability Impact on Reservoir Stress and Seismic Slip Behavior 2023 Annual Workshop Presentation

Sep 08, 2023
79.68 MB
Curated
This is a presentation on the Fracture Permeability Impact on Seismic Slip Behavior project by Lawrence Livermore National Laboratory, presented by Dr. Kayla A. Kroll. The project's objective is to develop, apply and validate a holistic thermal, hydrologic, mechanical, and chemic...
Authors
Kroll, K. et al Lawrence Livermore National Laboratory
geothermalenergyannual workshop2023utah forgeegsthmcinduced seismicityseismic slipearthquake simulationspressure statestress statepredictionsseismic hazardresource optimizationmitigationgeomechanicalgeochemicalslip-induced permeabilitycoupled processesfracture permeabilitypresentationstochastic parameter estimationslip simulation

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service