OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 14 of 14.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"low frequency EM method"×
Gravity×

Newberry EGS Literature References

Apr 22, 2016
69.94 kB
Publicly accessible
Research references to literature about the Newberry geothermal area, Oregon.
Authors
Rose, K. National Energy Technology Laboratory
geothermalegsenhanced geothermal systemnewberryoregonnewgengeophysicsgeologyhydrothermalseismicstructurep waveelectricmagnetotelluriclithologyliteraturefield guidegeologic historyvolcano hazardsframeworkpetrologyexploratory drillingslimholeexplorationflow testingdrillholestructuralactive sourceteleseismictomographyresource characterizationmagma chambercrustalvelocitygravityemelectricalcompressional wavecoremineralogy

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

Hawaii Play Fairway Analysis: Lanai Resistivity and Density 3D Inversion Models

Jun 01, 2020
42.2 MB
Publicly accessible
To prepare for its third phase, the Hawaii Play Fairway project conducted groundwater sampling and analyses in ten locations in the Hawaiian islands, magnetotelluric (MT) and gravity surveys, as well as calculations of 3D subsurface stress due to the weight of the rock underlying ...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaimagnetotelluricgravityhaleakalamauimauna keamtmasurveydatateststresssubsurfacevolcanoresistivitydensityfracture induced permeabilityegsenhanced geothermal systemresourcepotentialresource probabilityexploratory drilling

Magnetotelluric Data Collected in 2016 over the San Emidio Geothermal Field in Nevada

Nov 09, 2016
132.47 MB
Publicly accessible
This data set includes the magnetotelluric (MT) data collected from October 21 to November 9, 2016 over the San Emidio geothermal field in Nevada by Quantec Geoscience USA Inc. on behalf of US Geothermal Inc. as part of a project entitled "A Novel Approach to Map Permeability Usi...
Authors
Folsom, M. et al Ormat Technologies, Inc.
geothermalenergywholescalewaterholeobservationstresssystemspatialtemporalphysicsmodelinghydrologicthermalmechanicalprocessed datageophysicsintegrated geologic modelpassive micro-seismicgravitymagnetotelluricspacific dc intertie

Dixie Valley Engineered Geothermal System Exploration Methodology Project, Baseline Conceptual Model Report

Jan 02, 2014
504.96 MB
Publicly accessible
The Engineered Geothermal System (EGS) Exploration Methodology Project is developing an exploration approach for EGS through the integration of geoscientific data. The overall project area is 2500km2 with the Calibration Area (Dixie Valley Geothermal Wellfield) being about 170km2....
Authors
Iovenitti, J. AltaRock Energy Inc
geothermaldixie valleyegshydrothermal systemfavorability/trust mappingfinal scientific reportegs exploration methodologybob karlingravitystation locationcomplete bouguer anomalyphil wannamakermagnetotelluricsmetadatadatainversionquantecileana tibulecseismic velocity modelfletcher h ibsergeostatisticsgeophysics

Effectiveness of Shallow Temperature Surveys to Target a Geothermal Reservoir at Previously Explored Site at McGee Mountain, Nevada: Final Report for U.S. Department Of Energy Grant EE-0002830

Mar 07, 2014
2.23 MB
Publicly accessible
The McGee Mountain geothermal area was selected to test early-stage shallow temperature survey techniques and drill two slim holes to test the resource. Geothermal Technical Partners, Inc. was able to complete only a small portion of the project before lack of funding prevented f...
Authors
Zehner, R. Geothermal Technical Partners, Inc.
geothermalnevadamcgee mountainshallow temperature surveygeoprobegeochemistrygeologytransmissionreportgravitysurveyfeasibilityarchaeological clearancegeothermometrycost-effectivethermal anomaliescost

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Appalachian Basin Play Fairway Analysis: Thermal Quality Analysis in Low-Temperature Geothermal Play Fairway Analysis (GPFA-AB)

Nov 15, 2015
2.04 GB
Publicly accessible
This collection of files are part of a larger dataset uploaded in support of Low Temperature Geothermal Play Fairway Analysis for the Appalachian Basin (GPFA-AB). Phase 1 of the GPFA-AB project identified potential Geothermal Play Fairways within the Appalachian basin of Pennsylva...
Authors
E., T. Cornell University
geothermalappalachian basinnew yorkpennsylvaniawest virginialow-temperaturegeothermal play fairway analysisgpfa-abdeep direct usedistrict heatingthermal analysisresource assessmentheat flowthermal conductivitygeothermsshapefileregional gridrasterr scriptbasementtrenton black river projectsediment thicknessbht correctionrome troughgravitymagneticsworm based interpolation boundarieswormsrisk of seismicityoutlierthermal modelthermal fielddepth-to-temperaturetemperature-at-depthcross validationkrigingfavorable countiesarcgiscosunacorrelation of stratigraphic units of north americademdigital elevation modellow temperaturegeospatial datapfaplay fairway analysisthermal qualitycross-section

Colorado Potential Geothermal Pathways

Feb 01, 2012
68.99 kB
Publicly accessible
This layer contains the weakened basement rocks. Isostatic gravity was utilized to identify structural basin areas, characterized by gravity low values reflecting weakened basement rocks. Together interpreted regional fault zones and basin outlines define geothermal "exploration f...
Authors
E., R. Flint Geothermal, LLC
geothermalcoloradobasement weaknessgravityfaultsfluid flowbasement weaknessesarcgisshapefileshape filegeospatialgeospatial datadatageophysicsexplorationpfaplay fairwayanalysissuperheated fluid flowvolcanic activityremote sensingfault detectionanomaly detection

DEEPEN: Newberry Volcano MT and Gravity Data 2022 and 2023 Acquisition and Processing

Jun 30, 2023
306.16 GB
Publicly accessible
As part of DEEPEN (DE-risking Exploration of geothermal Plays in magmatic ENvironments), a 3D play fairway analysis (PFA) was conducted at Newberry Volcano in Central Oregon for multiple play types (conventional hydrothermal, superhot EGS, and supercritical). For use in this PFA, ...
Authors
Schultz, A. et al Enthalpion Energy
geothermalenergydeepennewberrymtgravityresistivitydensitysingle inversionjoint inversioninversionraw dataprocessed datauncertaintyresolution matrixexplorationcharacterizationegshydrothermalsuperhot egssupercriticalmagmaticgeophysicsmt impedance3-d modeldaily reportsoregonpfaplay fairway analysis

Alum Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
252.81 MB
Publicly accessible
Data generated from the Alum Innovative Exploration Project, one of several promising geothermal properties located in the middle to upper Miocene (~11-5 Ma, or million years BP) Silver Peak-Lone Mountain metamorphic core complex (SPCC) of the Walker Lane structural belt in Esmera...
Authors
Miller, C. Ram Power, Inc.
geothermalgravitymagneticsmtgeochemistryregional temperatureresource modelwell datageologyupper miocenesilver peaklone mountainwalker lanealumesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countygrav-magmagnetic3dprofileprofilesround 12009round 22010magnetotelluricsinversion30 ohm100 ohm300 ohmztemchemistrygeothermometrytemperaturehole 56-29historicshallowwell logsmoderngeologicgeomechanicsgeophysical25-2926-19geologyreportexecutive summarymapssectionsphotosphotographspicturesgeospatial data

Silver Peak Innovative Exploration Project (Ram Power Inc.)

Jan 01, 2010
463.6 MB
Publicly accessible
Data generated from the Silver Peak Innovative Exploration Project, in Esmeralda County, Nevada, encompasses a deep-circulation (amagmatic) meteoric-geothermal system circulating beneath basin-fill sediments locally blanketed with travertine in western Clayton Valley (lithium-rich...
Authors
Miller, C. Ram Power, Inc.
geothermalsilver peakgravitymagneticmtradiometricsregional temperatureremote sensingresource modelseismicfluid datawell dataphotosgeologywalker lanelate miocenepliocenelone mountainesmeralda countynevadagravity surveygridterrain5km10kmupward continued regional residualbougerhorizontal gravity gradientnorth americaimperial countymagnetic reporttmiigrftotal magentic intensitymagnetotelluric surveymt surveyresistivity3dground mtztemradiometric survey silver peak20102011temperatureshallow temperature gradienttemperature gradient holestghasterphotographs2dseismic reflection surveyfaultsmesquitefluidchemistrygeologymapgeospatial data

DEEPEN Leapfrog Geodata Model Cleaned and Reformatted Exploration Datasets from Newberry Volcano

Jun 30, 2023
413.96 MB
Publicly accessible
DEEPEN stands for DE-risking Exploration of geothermal Plays in magmatic ENvironments. As part of the DEEPEN 3D play fairway analysis (PFA) conducted at Newberry Volcano for multiple play types (conventional hydrothermal, superhot EGS, and supercritical), existing geoscientific e...
Authors
Pauling, H. et al National Renewable Energy Laboratory
geothermalenergydeepensuperhotsupercriticalsuperhot egsnewberrymagmatichydrothermalpfaprocessed dataexplorationcharacterizationdatasetsgeodata3dmodelingdemlidarmtmagnetotelluricsgravitydensityresistivityearthquake catalogseismicvelocitytemperature modelgeologic modelalteration modelwell data

INGENIOUS Great Basin Regional Dataset Compilation

Jun 30, 2022
116.98 MB
Publicly accessible
This is the regional dataset compilation for the INnovative Geothermal Exploration through Novel Investigations Of Undiscovered Systems (INGENIOUS) project. The primary goal of this project is to accelerate discoveries of new, commercially viable hidden geothermal systems while re...
Authors
Ayling, B. et al GBCGE, NBMG, UNR
geothermalenergy2-meter probetemperaturegeochemistryquaternary falutsquaternary volcanicsgeodeticsseismicitypaleogeothermalwellsspringsslip and dilationingeniousplay fairway analysisgreat basinnevadautahidahocaliforniaoregonthermal conductivitymagnetotelluricsgravitymagneticsheat flowshapefilesgridssinterslipdilationearthquakesshearconductivityconductancegeotiffgeospatialcompilationdataregionaltufavolcanicsexplorationplay fairwaymodelingundiscovered systemsdiscoveryfavorabilityfaultsmachine learningelevation trenddetrended elevationseismic dataraw datasoda lake
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service