OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 140.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"mineral mountains"×

Utah FORGE: Mineral Mountains West Fault System Report

Jul 01, 2019
25.06 MB
Publicly accessible
This archive contains a report on the Mineral Mountains West fault system as part of phase 2C and the evidence for the northern terminus of this structure. Geologic field mapping, reprocessing of 3D seismic reflection data, and soil gas surveys contributed to this effort.
Authors
Simmons, S. and Miller, J. Energy and Geoscience Institute at the University of Utah
geothermalenergymineral mountainsutah forge phase 2cutah forgegeologic structurefaultsutah forge faultsmineral mountains west fault systemnorth milford valleyutahstructural geologysoil gas geochemistryphase 2c3d seismicgeochemicalgeophysicalgeologicalseismic reflectionfaultwell 58-32hydrothermal fluid flowhydrothermalco2 fluxhelium isotopessoil gasfault mappingsurface mappinggeomorphic analysisstratigraphyforgeegsroosevelt hot springsmilfordgeologygeophysicsgeochemistryseismic

SubTER Final Magnetotelluric (MT) Data: Mineral Mountains, Utah

Oct 13, 2021
15.16 MB
Publicly accessible
Subsurface Science, Technology and Engineering Research, and Development (SubTER) Crosscut is a collaboration across the Department of Energy offices involved in research activities in energy production/extraction, subsurface storage, and environmental remediation. This submission...
Authors
Wannamaker, P. Energy and Geoscience Institute at the University of Utah
geothermalenergysubtersubter mtmagnetotelluric datamt datamineral mountainsmineral mountains mtutah subterutah mtutahmagneticsgeophysicsprocessed datadatamagnetotelluricmtmt soundings

SubTER ZTEM (Z-Axis Tipper Electromagnetic) Survey Results, Mineral Mountains Area, Utah

Oct 13, 2021
33.93 MB
Publicly accessible
This data was acquired as part of the Subsurface Science, Technology and Engineering Research, and Development (SubTER) Crosscut which is a collaboration across the Department of Energy offices involved in research activities in energy production/extraction, subsurface storage, an...
Authors
Wannamaker, P. Energy and Geoscience Institute at the University of Utah
geothermalenergyztem surveyztem mineral mountainssubter ztem surveyutah ztem surveyz-axis tipper electromagneticutahmineral mountainssubsurface storageproductionextractionenvironmental remediationroosevelt hot springsgeothermal areaprocess datamapsairborne ztemairborne surveysurveygeological survey

Utah FORGE: Area LiDAR Bare Earth DEM Mosaic

Aug 07, 2018
6.86 GB
Publicly accessible
This is a mosaic of 154 bare earth DEM panels (0.5 m resolution) acquired during Phase II of the Utah FORGE project. The DEM covers the western Mineral Mountains and adjoining basin including the Roosevelt Hot Springs area. The coordinates are in UTM Zone 12, NAD 83 and elevation ...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergylidarlidar demlidar bare earthroosevelt hot springsutah forgeforgedigital elevation modelfrontier observatory for research in geothermal energyutahutgeospatial databare earthmodelgeotiffremote sensingdemphase 2elevationegsmilfordprocessed datamineral mountains

Utah FORGE: Faults, Fractures, and Lineaments in the Mineral Mountains

Mar 09, 2016
2.92 MB
Publicly accessible
This submission includes a shapefile of the Opal Mound Fault, and multiple datasets of lineaments mapped in the Mineral Mountains which overlook the Utah FORGE site, hyperlinked to rose diagrams in a polygon grid shapefile.
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalforgelineamentsfracturesfaultsutahmilfordopal moundlineamentfracturejointegsmineral mountainsfaultopalmoundshapefileshape filearcgisgeospatial datautah forgegeologystructuralroosevelt hot springsrose diagram

Utah FORGE: Temperature Contours at 200 m

Feb 01, 2016
19.09 kB
Publicly accessible
The individual shapefiles in this dataset delineate estimated temperature contours (20, 40, 60, and 80 deg C) at a depth of 200 m in the Milford, Utah FORGE area. Contours were derived from 86 geothermal, gradient, and other wells drilled in the area since the mid-1970s with dept...
Authors
Moore, J. Energy and Geoscience Institute at the University of Utah
geothermalmilfordforgeutahegstemperature200 mcontour20406080shapefileshape filearcgisgisgeospatial datautah forgeresourcecharacterizationroosevelt hot springscontoursprocessed datamineral mountainscove fortwell data

Utah FORGE: Southwestern Utah Magnetotelluric (MT) Data

Jan 22, 2024
234.04 MB
Publicly accessible
This comprehensive magnetotellurics (MT) dataset, which covers southwestern Utah, integrates 600 sites from various surveys, including those from the Utah FORGE, SubTER, and Play Fairway projects, all of which are linked below. The core of this dataset is the use of a 3D finite el...
Authors
Wannamaker, P. and Marris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgemtmagnetotelluricresistivitysouthwestern utahplay fairwaygeophysical datafinite elementfeafemgravitymagneticsseismicgeodesyegsroosevelt hot springsmilfordsite characterizationforge mtplay fairway analysisforgesubter

Rare Earth Element and Trace Element Data Associated with Hydrothermal Spring Reservoir Rock, Idaho

Jun 22, 2017
543 kB
Publicly accessible
These data represent rock samples collected in Idaho that correspond with naturally occurring hydrothermal samples that were collected and analyzed by INL (Idaho Falls, ID). Representative samples of type rocks were selected to best represent the various regions of Idaho in which ...
Authors
Quillinan, S. and Bagdonas, D. University of Wyoming
geothermalenergyidahorare earth elementreehydrothermaltracemajorelement concentrationscontent modelusginaasg geothermal datangds

Preliminary Geologic Map of the Bunejug Mountains Quadrangle, Churchill County, Nevada Salt Wells Geothermal Area

Oct 31, 2011
6.63 MB
Publicly accessible
The data in this submission includes a geologic map of the Salt Wells Geothermal Area. The map is in pdf format. The map includes locations of quaternary deposits, tertiary volcanic rock, sedimentary deposits, and tertiary intrusions. The map legend and scale can be found on the m...
Authors
Hinz, N. et al University of Nevada
geothermalsalt wells geothermal areanevadagreat basinbasin and rangegeologic mapmapchurchill countybunejug mountains quadranglesalt wellsgeology

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Tularosa Basin Play Fairway Analysis: Geologic Map of the Organ Mountains and Southern San Andres Mountain Range, NM

Jun 16, 2017
724.36 kB
Publicly accessible
This is a digitized geologic map, in shapefile format, including rock unit lithological descriptions, faults, and dikes.
Authors
Nash, G. and Seager, W. Energy and Geoscience Institute at the University of Utah
geologynew mexicomapfaultssan andresorgan mountainsdikeslithologygeologic layergeologic mapstratigraphyshape fileshapefilearcgisgisgeospatialgeospatial datapfa

Utah FORGE: TEM and Gravity Data

Feb 05, 2018
1.62 MB
Publicly accessible
This submission includes a gravity data in text format and as a GIS point shapefile and transient electromagnetic (TEM) raw data. Each text file additionally contains location data (UTM Zone 12, NAD83) and elevation (meters) data for that station. The gravity data shapefile was i...
Authors
Hardwick, C. and Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgegravity datagravitygeophysicsroosevelt hot springmilfordmineral mountainsutahgisarcgisgeospatial datageophysicalsurveyshapefileshape filedata reductionbouger anomalycorrectionstransient electromagnetic datatem datageophysical dataroosevelt hot springsgeospatialelectromagneticsfrontier observartory for research in geothermal energyforgetext filetime-domain emtemegsprocessed dataraw data

3D Model of the Tuscarora Geothermal Area

Dec 31, 2013
43.8 MB
Publicly accessible
The Tuscarora geothermal system sits within a ~15 km wide left-step in a major west-dipping range-bounding normal fault system. The step over is defined by the Independence Mountains fault zone and the Bull Runs Mountains fault zone which overlap along strike. Strain is transferre...
Authors
E., J. University of Nevada
geothermal3d modeltuscarora geothermal areafaultingfaultsstratigraphystratigraphic unitscross-sectioncross sectiongeologygeologic unitsgeologic contacttuscaroradatageospatial data

Technology Development and Field Trials of EGS Drilling Systems at Chocolate Mountain

Jan 01, 2012
23.51 MB
Publicly accessible
Polycrystalline diamond compact (PDC) bits are routinely used in the oil and gas industry for drilling medium to hard rock but have not been adopted for geothermal drilling, largely due to past reliability issues and higher purchase costs. The Sandia Geothermal Research Departmen...
Authors
Knudsen, S. et al Sandia National Laboratories
geothermalchocolate mountainsdrillingpdc bitroller conegranitechocolate mountains drillingsynthetic diamondrate of penetrationegslateral vibration spectrumcaliforniacasouthern californiasocaldrilling recordsperformance datadrilling chartsbefore and afterpicturesvibration spectrum

Spatially Referenced Geodatabase for Coso Geothermal Area

Dec 01, 2022
110.41 MB
Publicly accessible
Mineral, Temperature, Gravity, and Fault Density maps in the Coso Geothermal Field in California.
Authors
Demir, E. et al Colorado School of Mines
geothermalenergygeologygeophysicsgravitytemperaturemineralgeospatialrastercosocalifornia

Portland DDU Feasibility Study: The Spatial and Temporal Evolution of the Portland and Tualatin Basins, Oregon, USA

Jul 29, 2019
5.52 MB
Publicly accessible
The Portland and Tualatin basins are part of the Puget-Willamette Lowland in the Cascadia forearc of Oregon and Washington. The Coast Range to the west has undergone Paleogene transtension and Neogene transpression, which is reflected in basin stratigraphy. To better understand th...
Authors
Scanlon, D. Portland State University
geothermalenergytetonic eveolutionisochore mapsmodelingtop crbgeocene basementpaleogeneneogeneresource assementspatialtemporalportlandtualatin basinoregongeophysicsgeophysicalgeothermal exploration

Geothermal Mineral Alterations in Brady and Desert Peak

May 15, 2021
1.54 GB
Publicly accessible
Results of the analysis of HyMap's spectra against know hydrothermally altered minerals in the Brady-Desert Peak Geothermal Areas. This is the post-processing results and final analysis results of applying target detection algorithms and then fusing the results.
Authors
Moraga, J. Colorado School of Mines
geothermalenergymineral alterationshydrothermal alteration mineralshymapbradydesert peakgeospatial datadataprocess dataremote sensingtarget detectionspectral analysisgeothermal areanevada

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Utah FORGE: Well 58-32 Stimulation Conference Paper and Data

Apr 24, 2019
1.8 MB
Publicly accessible
The U.S. Department of Energy's (U.S. DOE) Frontier Observatory for Research in Geothermal Energy (FORGE) is a field laboratory that provides a unique opportunity to develop and test new technologies for characterizing, creating and sustaining Enhanced Geothermal Systems (EGS) in ...
Authors
Best, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeopen hole stimulationwell 58-32 stimulationwell 58-32utah geothermalgrgegsdisccrete fracture flowreservoir stimulationstimulationhydraulic fracturingphase 2cforgepressureflowbackratetemperaturehydraulicflowutahopen-holemilfordroosevelt hot springspre-processedupper perforationlower perforationmicroseismicitydasdistributed acoustic sensinggeophysics

New Mexico Play Fairway Analysis: Gamma Ray Logs and Heat Generation Calculations for SW New Mexico

Oct 23, 2015
1.43 MB
Publicly accessible
For the New Mexico Play fairway Analysis project, gamma ray geophysical well logs from oil wells penetrating the Proterozoic basement in southwestern New Mexico were digitized. Only the portion of the log in the basement was digitized. The gamma ray logs are converted to heat pro...
Authors
Kelley, S. New Mexico Bureau of Geology and Mineral Resources
geothermalheat generationgamma logssouthwestern new mexicogamma ray logsoil wellsgamma raypfanew mexiconmsouthwestgeophysicsgeophysicalexplorationdownholeboreboreholewell dataheatgeneration

Retrospective Analysis of Geothermal Mineral Recovery and Domestic Resource Assessment References

Oct 20, 2021
1.69 MB
Publicly accessible
This reference database in RIS format contains all of the references that were collected as part of our retrospective analysis of geothermal mineral recovery (REE and Li) activities and domestic resource assessment. The outputs detail the chemistry and molecular processes used in ...
Authors
Dobson, P. and Stringfellow, W. Lawrence Berkeley National Laboratory
geothermalenergylithiumreemineral recoveryrecoverygeothermal brinesbrinesgeochemistytechnologydomestic resourceresourcemineral

Manganese Uptake of Imprinted Polymers

Sep 30, 2015
477.5 kB
Publicly accessible
Batch tests of manganese imprinted polymers of variable composition to assess their ability to extract lithium and manganese from synthetic brines at T = 45 deg C . Data on manganese uptake for two consecutive cycles are included.
Authors
Ventura, S. SRI International
geothermalbrinemanganesepolymer sorbentgeothermal mineral recoveryremoval efficiencymanganese uptakengdsusgincontent modelmineral brine recovery

Utah FORGE: Phase 3 Magnetotelluric (MT) Data

Oct 01, 2020
91.86 MB
Publicly accessible
New high-quality tensor MT data at 122 sites, including the vertical magnetic field and utilizing ultra-remote referencing, have been acquired over the Utah FORGE project area. The results will be used to delineate the densities of faults and fractures in crystalline basement rock...
Authors
Wannamaker, P. and Maris, V. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forge mtmt datamagnetotelluric datautah forgeforgeutah geothermalgeophysical datafinite elementfeafemgeophysicsgravitymagneticsmagnetotelluricsseismicgeodesyegsroosevelt hot springsmilfordsite characterization

In-Situ Process for Sorption and Stripping of Rare Earth Elements from Simulated Geothermal Brine

May 24, 2016
14.05 kB
Publicly accessible
Description of a conceptual commercial process to remove rare earth elements (REEs) from geothermal brine, based on a small-scale laboratory experiment to load, strip, and regenerate a ligand-based media used to adsorb REEs from a simulated brine doped with known mineral concentra...
Authors
Stull, D. Tusaar Corp.
geothermalbrinerare earth elementsreeadsorptionmineral recoveryprocesssimulated brinebrine studymineral doping

Utah FORGE: Well 16B(78)-32 Cuttings X-Ray Diffraction Data

Apr 20, 2025
17.99 kB
Publicly accessible
X-ray diffraction (XRD) results from cuttings samples collected during drilling of Utah FORGE well 16B(78)-32. The dataset includes XRD data for 77 samples taken between 3,120 and 10,977 feet measured depth (from the Kelly Bushing, 31 feet above ground level), with sampling interv...
Authors
Jones, C. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 16bwell 16b78-32xrdx-rayx-ray diffractionmineralogymineralspetrographywell cuttings analysismineral abundancetrace mineralsweight percentsubsurface geologygeologyrock cuttingsmeasured depthkelly bushingprocessed dataegs
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service