OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 47.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"stress evolution"×
Seismic×

Utah FORGE 5-2419: Final Report and Presentation on Seismicity Permeability Relationships Probed via Nonlinear Acoustic Imaging

Sep 30, 2025
254.88 MB
Curated
This submission contains the final technical report and closeout presentation for Utah FORGE Project 5-2419, which investigates the coupled evolution of permeability and induced seismicity in enhanced geothermal systems using laboratory experiments, field observations, and nonline...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegspermeabilityinduced seismicitylaboratory experimentsfield observationsnonlinear acoustic imagingfault reactivationreservoir rockmicroearthquakestimulationphysics informed modelingmachine learningseismic momentstress statepermeability creationseismic hazardtechnical reportgeomechanicsgeophysicsmicroseismicity

Utah FORGE: Laboratory Fault Reactivation and Permeability Evolution During Fluid Injection

Sep 15, 2025
182.35 GB
Curated
This dataset contains results from controlled shear reactivation experiments performed on cylindrical Westerly and granitoid granite samples with a single inclined fracture. Laboratory faults were pre-loaded near failure and reactivated by fluid injection to examine relationships ...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergyinduced seismicityutah forgewesterly granitegranitoidpermeabilityshear stimulationegsfault reactivationfluid injectionpermeability evolutionseismicityacoustic emissionssingle inclined fractureshear stresspore pressuretriaxial testingmechanical datageomechanicsraw dataprocessed dataacoustic data

Utah FORGE 5-2419: Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging 2025 Workshop Presentation

Sep 18, 2025
128.96 MB
Curated
This is a presentation on the Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging project by Pennsylvania State University, presented by Derek Elsworth. The project's objectives were to explore controls and acoustic signatures of aseismic through seismic ev...
Authors
Elsworth, D. Pennsylvania State University
geothermalenergyutah forgeegsseismicitypermeabilitynonlinear acoustic imagingfracture reactivationfriction stabilitystress statestimulationgeomechanics2025 annual workshoppresentationpresentation recordingpresentation slidesreport

Penn State Lab Testing Fluid-Rock Interaction in Geothermal Reservoirs

Jan 01, 2018
5.53 GB
Publicly accessible
This project focused on assessment and discovery of fluid-rock interaction in geothermal reservoirs. We accomplished work in four main areas: 1) fracture formation and the relationship between fluid flow and shear failure, 2) assessment of fracture geometry and fluid permeability ...
Authors
Madara, B. et al Pennsylvania State University
geothermalenergylab testingfracture formationshear failurefluid flowfracture geometryfluid permeabilityacoustic measurementsinjectionseismicitytriaxial experimentsdynamic stressingreservoir permeabilityfracture flowpermeability evolutionacoustic fracture characterizationfrictional stabilitydynamic triggeringinjection induced seismicityinduced seismicityshear slipshear flowberea sandstonewesterly graniteegsacoustic emissionslab earthquakes

Utah FORGE 5-2557: Final Report and Presentation for the Role of Fluid and Temperature in Fracture Mechanics and Coupled THMC Processes for Enhanced Geothermal Systems

Nov 30, 2025
163.74 MB
Curated
This contains a final technical report and closeout presentation recording summarizing the results from Utah FORGE Project 5-2557 on the role of fluid pressure and temperature in fracture mechanics and coupled thermo-hydro-mechanical-chemical (THMC) processes relevant to enhanced ...
Authors
Pyrak-Nolte, L. Purdue University
geothermalenergythermo-hydro-mechanical-chemicalthmcutah forgeegstechnical reportlaboratory experimentstheoretical developmentsnumerical simulationscirculation testsfracture slippermeability evolutionseismicaseismicmoose farmfriction theoryaijoint inversion

EGS Collab Experiment 1: SIMFIP Notch-164 GRL Paper

Sep 24, 2020
11.52 MB
Publicly accessible
Characterizing the stimulation mode of a fracture is critical to assess the hydraulic efficiency and the seismic risk related to deep fluid manipulations. We have monitored the three-dimensional displacements of a fluid-driven fracture during water injections in a borehole at ~1.5...
Authors
Guglielmi, Y. Lawrence Berkeley National Laboratory
geothermalenergysimfipnew borehole instrumenthydrofractureegs collabnucleateanisotropyshear displacementwellboreexperimentstimulationseismicseismicityfracturehydraulic conductivitystressshearboreholemicro-shearingfoliationinjection testsanford underground research facilitysurfegshydraulicgeophysicsdisplacementflow rate

EGS Collab Experiment 1: In-situ observation of pre-, co and post-seismic shear slip preceding hydraulic fracturing

May 22, 2018
136.27 MB
Publicly accessible
Understanding the initiation and arrest of earthquakes is one of the long-standing challenges of seismology. Here we report on direct observations of borehole displacement by a meter-sized shear rupture induced by pressurization of metamorphic rock at 1.5 km depth. We observed the...
Authors
Guglielmi, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyegsegs collabsurfsanford underground research facilityseismicinjection teststimulationslip vectorshearaxialdisplacementpressureborehole displacementdeformationsimfipprobeboreholee1-ipre-slipco-seismicslippost-seismicaftersliphydraulicfracturingin-situ

Utah FORGE 5-2419: Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging 2024 Annual Workshop Presentation

Sep 05, 2024
126.38 MB
Publicly accessible
This is a presentation on Seismicity-Permeability Relationships Probed via Nonlinear Acoustic Imaging by Pennsylvania State University, presented by Derek Elsworth. This video slide presentation discussed controls and acoustic signatures of aseismic through seismic evolution of re...
Authors
Elsworth, D. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeaseismic evolutionfriction-stability-permeabilitypermeabilityfracturesshear-reactivationshearstimulationreservoir stimulationseismicityfracfracingwell stimulationpetrophysicsgeomechanicshthppennsylvania state universityvideopresentationegs

STRESSINVERSE Software for Stress Inversion

Oct 31, 2018
Size unavailable
Publicly accessible
The STRESSINVERSE code uses an iterative method to find the nodal planes most consistent with the stress field given fault frictional properties. STRESINVERSE inverts the strike, rake and dip from moment tensor solutions for the in-situ state of stress. The code iteratively solves...
Authors
Gritto, R. Array Information Technology
geothermalenergystress inversioninversionstressseismicanalysisstressinversejointfault orientationmatlabcodenumericalmomenttensorsoftwarepassivefaultfaultingearthquakeorientationgeophysicsgeophysicalmicroseismicityinducedseismicitystimulationegsinjectionfracturemonitoringhydraulicgeneration

Utah FORGE 2439: Machine Learning for Well 16A(78)-32 Stress Predictions

Jun 19, 2023
2.3 MB
Publicly accessible
This report reviews the training of machine learning algorithms to laboratory triaxial ultrasonic velocity data for Utah FORGE Well 16A(78)-32. Three machine learning (ML) predictive models were developed for the prediction of vertical and two orthogonally oriented horizontal str...
Authors
Kelley, M. et al Battelle Memorial Institute
geothermalenergymachine learningin-situ stressstress characterizationutah forgegeophysicsseismictriaxialstress predictionartificial neural networkmodelfeed forward artificial neural network

Utah FORGE: 2024 Stress-Shadow Seismic Survey

May 29, 2026
Size unavailable
Curated
This dataset documents the FORGE 2024 stress-shadow seismic survey done in collaboration with the EarthScope Consortium. Original seismic waveform data are archived through EarthScope/NSF SAGE dataset 24-021. This GDR submission provides a link to the original EarthScope archive. ...
Authors
Dvory, N. and Deo, M. The University Of Utah
geothermalenergyoriginal seismic waveformutahseismic survey2024 stimulationmicroseismicityforgestress-shadowegswaveformmetadataraw data

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Full Moment Tensors and Stress Inversion Catalogs

Sep 26, 2018
51.03 kB
Publicly accessible
This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the P...
Authors
Gritto, R. et al Array Information Technology
geothermalenergyseismic moment tensorstress orientationstress changesinversiongeysersegsenhanced geothermalazimuthplungemincroseismicityinjectionstimulationreservoirthe geysershigh temperature reservoirfull mtsolutionspassiveseismicseismicitymicroseismicitymonitoringarraymomenttensorcataloganalysisinducedstressprati 32demonstrationfracturespatio-temporalgenerationresourcedevelopmenthydraulicfaultingfaultearthquakegeophysicsgeophysical

Utah FORGE: Fluid Injection Induced Shearing Experiments on Fractured Granitoid at Elevated Temperatures

Aug 12, 2024
80.21 MB
Publicly accessible
This repository contains experimental data from a series of fluid injection-induced shearing tests conducted on Utah FORGE granitoid. The experiments were performed using an aluminum triaxial pressure vessel (TEMCO) apparatus at Pennsylvania State University. The primary aim was t...
Authors
Elsworth, D. et al Pennsylvania State University
geothermalenergytemperatureexperimentpre-stressseismicityutah forgeegsgranitoidtemcotriaxial pressure vesselfault seismicitypre-stress ratioshearpore pressure60-gritinclined fracture

Utah FORGE 3-2417: DAS Microseismic Event Catalog from the 16A/16B Circulation Test, 2023

Jun 12, 2024
2.41 MB
Curated
This preliminary data archive includes the relocated microseismic event catalog, 1D velocity model, and methods report from DAS acquisition conducted during the Well 16A and 16B circulation test (July 19th and 20th, 2023) at Utah FORGE. The methods report describes all processing ...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyforgeutah forgeegsenhanced geothermaldasdistributed acoustic sensingmicroseismicevent catalogevent detectionfogmoreinversiongeophysicsreal-time16a16bcirculation testconnectivitymethodsrelocationhierarchical clusteringprocessed data

Utah FORGE 3-2417: DAS Microseismic Event and MT Catalog from the 16A/16B Circulation Test [Final, Relocated], 2023

May 19, 2025
1.34 MB
Curated
This data archive includes the relocated microseismic event catalog from distributed acoustic sensing (DAS) acquisition conducted during the 16A-16B circulation tests that took place in July 2023. These results update the catalog presented in GDR 1613 (the preliminary catalog, lin...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalevent catalog16a16bcirculationcirculation testinversionseismic eventsevent detectionmtdistributed acoustic sensingprocessed datamicroseismic event catalogmeqfogmore

Utah FORGE: Temperature-Dependent Fracture Seismicity from Fluid Injection Experiments

Feb 29, 2024
4.34 MB
Publicly accessible
This dataset contains experimental data from fluid injection experiments conducted to investigate the influence of temperature on fracture seismicity. The experiments were performed on granite samples from Utah FORGE. The samples were prepared with a 30-degree inclined fracture an...
Authors
Wang, J. et al Pennsylvania State University
geothermalenergyegstemperaturefracture seismicityfluid injectionshear stressdisplacementpore pressureexperimental geomechanicsgeomechanicshigh temperature rock mechanicsraw dataseismicitygraniteutah forgefracture mechanicsstimulation

Appalachian Basin Play Fairway Analysis Gravity, Magnetics, and Earthquake Data

Jul 20, 2016
151.65 MB
Publicly accessible
This archived dataset contains magnetic and gravity imaging data for the Appalachian Basin, compiled using Poisson Wavelet Multiscale Edge Detection, referred to as 'worm' for brevity, and stored in a PostGIS database, along with shapefiles and CSVs of relevant data. The archive ...
Authors
Horowitz, F. Cornell University
geothermalinduced seismicitygravitymagneticspoisson wavelet multiscale edge detectionwormsworld stress mapearthquakeseast coast earthquakesshapefilesgispostgissqlappalachian basinnew jerseynew yorkwest virginiapennsylvaniaphiladelphiaontariaquebeczipfilecsvzipxlsshapefiletifmagneticimagingwormearthquake datapfageophysicsgravmageqseismicitymeqmicroearthquakemicroseismicitynaturalrisk assessmenthazardgeospatial datageotifflow temperature

Processed Lab Data for Neural Network-Based Shear Stress Level Prediction

May 14, 2021
6.01 MB
Publicly accessible
Machine learning can be used to predict fault properties such as shear stress, friction, and time to failure using continuous records of fault zone acoustic emissions. The files are extracted features and labels from lab data (experiment p4679). The features are extracted with a n...
Authors
Marone, C. et al Pennsylvania State University
geothermalenergymatlabgeophysicsseismiccodeprocessed datamicroseismicityaiartificial intelligencedeep learningmachine learningacousticsacoustic emissionsseismic forcastingseismic predictionfaultfault propertiesshear stresstime to failureexperimentexperimental datalab databiaxial shear experimentbiaxial shear apparatusfriction

Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development Deviatoric MT, Fracture Network, and Final Report

Sep 01, 2018
62.11 kB
Publicly accessible
This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fra...
Authors
Gritto, R. et al Array Information Technology
geothermalenergythe geysershigh temperature reservoirdeviatoric mt solutionsdeviatoricstresstensorcatalogmomentseismicityanalysisegsinjectioninducedmicroseismicityeventlocationshearstrainfracture networkfracture orientationfracture sizecaliforniacafaultfracturenetworkgeysersmicroseismichypocenterspassiveseismicmonitoringstimulationfinal reportinversionhydraulicfaultingearthquakegeophysicsgeophysical

Utah FORGE: Final Topical Report 2018

Apr 07, 2018
173.06 MB
Publicly accessible
This is the final topical report for the Phase 2B Utah FORGE project, which is located near Roosevelt Hot Springs, Utah. This PDF format report details results associated with the conceptual geologic model, deep well 58-32, rock geomechanics, reservoir temperatures, seismic survey...
Authors
Moore, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyforgeutah forgeroosevelt hot springsutah forge phase 2butah forge 2b final reportutah forge final reportutah forge 2bconceptual geologic modelgeologystructuralsoil gas surveyseismic reflectiontemperature profilewell 58-32geomechanical propertiesstress analysisseismic monitoringmicroseismicityinduced seismicityseismicitytemtransient electromagneticspermeabilitypetrology cuttingsco2hecarbon dioxideheliumismpinduced seismicity mitigation planenvironmental impact assessmenttechno-economic assessmentoutreachgeophysicswellpetrologyhydrochemistryfracturesgravitypermittinginfrastrutureseismic mitigationenvironmental assessmentrock stressgeomechanicssoil gasdfnconstructionquaternary faultsutahegsmilford

Utah FORGE 3-2417: DAS Microseismic Event Catalog from April 2024 Stimulation

Jun 09, 2025
9.11 MB
Curated
This data archive includes the relocated microseismic event catalog and 3D velocity model from DAS acquisition conducted during the 16A stimulations that took place between April 3rd and April 7th, 2024. The catalog consists of multiple CSV files, each named after the associated s...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicegsenhanced geothermalfogmoreevent catalogcatalogmicroseismic eventsilixadistributed acoustic sensingidas16astimulationprocessed datavelocity modeldelano

Utah FORGE 3-2417: DAS-derived Moment Tensors from the 16A/16B Stimulation April, 2024

Aug 22, 2025
1.41 MB
Curated
This dataset contains a catalog of moment tensors derived from distributed acoustic sensing (DAS) data acquired during stimulation of Utah FORGE Well 16A, conducted between April 3 and April 7, 2024. The data were generated as part of the FOGMORE (Fiber Optic MOnitoring for Reserv...
Authors
Vera Rodriguez, I. et al Rice University
geothermalenergyutah forgedasmicroseismicmoment tensorenhanced geothermalegsfogmoresilixa16a stimulationdistributed acoustic sensingfiber opticsseismic monitoringstimulationmicroseismicitycarinaidasseismic inversiongeophysicssubsurface characterizationseismic momentconfidence indexcondition numbermoment catalogprocessed data

Fallon FORGE: Distinct Element Reservoir Modeling

Mar 12, 2018
57.97 MB
Publicly accessible
Archive containing input/output data for distinct element reservoir modeling for Fallon FORGE. Models created using 3DEC, InSite, and in-house Python algorithms (ITASCA). List of archived files follows; please see 'Modeling Metadata.pdf' (included as a resource below) for addition...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyegsforgefallonnevadastresshydro-shearinghydraulic fracturesgeomechanicsthermalmicroseismicitygeometrycirculationstimulationreservoir modelvetted-nopython codescriptmicroseimicwell trajectoriesfracture aperturehydroshearingstereonet plotspercent fracture slip vs pressureinjectionstressesdfngeologic structurejoint networkleakoff ratioshear stimulatedshear displacementnormal displacementopenholecasedthermal drawdownseismicitywell locationsreservoir mappingmiocroearthquakesmeqthermal modelingfracture tendancymicroseismicanalysisanalysesmodellingmodelreservoir

Directional Cooling-Induced Fracturing Westerly Granite Test Results

Dec 18, 2020
72.48 MB
Publicly accessible
Directional Cooling-Induced Fracturing (DCIF) experiments were conducted on a short, cylindrical sample of Westerly granite (diameter = 4 inches, height ~ 2 inches). Liquid nitrogen was poured in a copper cup attached to the top of the sample, and the resulting acoustic emissions ...
Authors
Nakagawa, S. Lawrence Berkeley National Laboratory
geothermalthermal crackingacoustic emissionstemperature changeslaboratory experimentwesterly granitegranitemoment tensorfractureseismicgeophysicsliquid nitrogenthermaltemperaturestimulationdirectional coolinginduced fracturingdirectional cooling-induced fracturingwellborestressvelocitytomographymicrocracking

Utah FORGE 3-2417: Low Frequency Distributed Acoustic Sensing Data from 16A/16B Stimulation April, 2024

Jul 23, 2025
37.13 GB
Curated
This dataset contains processed low-frequency Distributed Acoustic Sensing (LF-DAS) data collected between April 2 and April 12, 2024, during the Utah FORGE stimulation sequence involving wells 16A and 16B. The DAS measurements were acquired using a Silixa Carina interrogator unit...
Authors
Zhu, R. et al Rice University
geothermalenergyutah forgeegsenhanced geothermal systemsdistributed acoustic sensingdaslow-frequency dasfiber optic sensingsilixa carinafogmorewell 16bstimulationnanostraindfostime-series dataprocessed datasubsurface monitoringseismiclf-dasgeophysics
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service