OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 566.
Show results per page.
Order by:
Available Now:
Filters
Topic
Technologies
Demonstration Sites
Data Type
"temperature gradients"×

Utah FORGE: Temperature Gradient Database

Feb 01, 2004
Size unavailable
Publicly accessible
This is a temperature gradient database for Utah, USA. It is located at the Utah Geological Survey. This contains data relevant to the Utah FORGE project.
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermaltemperature gradientsutah temperature gradientsforgeutah forgeegsutah geothermalutahtemperaturegradienttemperature gradientresourcecharacterizationmilfordroosevelt hot springs

New Mexico Play Fairway Analysis: Wells and Springs with Discharge Temperature Higher than 30 deg C

Jun 16, 2015
2.34 MB
Publicly accessible
This submission includes three files from two sources. One file is derived from USGS data and includes a series of manipulations to evaluate only shallow wells with high estimated geothermal gradients. Two other files are springs and wells with discharge temperatures above 30 deg...
Authors
Kelley, S. New Mexico Bureau of Geology and Mineral Resources
geothermaldischarge temperature above 30 deg cnew mexico30cdischarge tempwell datadischarge temperaturewellstemperaturedischargepfaplay fairway analysischaracterizationexplorationspringshigh

West Flank Coso FORGE: 3D Temperature Model

Mar 01, 2016
603.86 kB
Publicly accessible
x,y,z data of the 3D temperature model for the West Flank Coso FORGE site. Model grid spacing is 250m. The temperature model for the Coso geothermal field used over 100 geothermal production sized wells and intermediate-depth temperature holes. At the near surface of this model,...
Authors
Blankenship, D. Sandia National Laboratories
geothermalforgeegswest flankcosotemperaturetemperature gradientcaliforniamodel3d

University of Illinois Campus Deep Direct-Use Feasibility Study Subsurface Temperature Profile

Jun 13, 2018
128.44 kB
Publicly accessible
High resolution fiber-optic distributed temperature sensing logs from the Illinois Basin Decatur Project (IBDP) in Decatur, IL were used to model the thermal profile in the Illinois Basin.
Authors
Lin, Y. et al University of Illinois
geothermalenergyddudeep direct-useuniversity of illinoisillinois basintemperature profiledtsdistributed temperature sensingtemperature gradient

Penrose Well Temperatures

Mar 15, 2013
6.69 kB
Publicly accessible
Penrose Well Temperatures Geothermal waters have been encountered in several wells near Penrose in Fremont County, Colorado. Most of the wells were drilled for oil and gas exploration and, in a few cases, production. This ESRI point shapefile utilizes data from 95 wells in and a...
Authors
Christopherson, K. Flint Geothermal, LLC
geothermalcoloradofremont countytemperature gradientsoil and gas wellstemperature gradientpoint shapefileshapefileshape filewell datatemperaturepenrose welldatageospatial data

Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster Files

Oct 09, 2015
117.95 MB
Publicly accessible
Snake River Plain Play Fairway Analysis Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers c...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoplay fairway analysispfagroundwater temperatureresource assessmentsite characterizationheatpermeabilitysealgravitymagneticdilation tendancyfaultingfaultsheat sourceventsedimentslip tendancyaquifersrp

Sedimentary Geothermal Feasibility in Nevada, Western Utah, Colorado, and the Gulf Coast Region of Texas Final Report

Jul 01, 2020
Size unavailable
Publicly accessible
The objectives of this project were to (1) perform a literature review of sedimentary geothermal resources, (2) identify data sources and develop data-collection methodologies that characterize selected resources, (3) screen sedimentary basins and formations for sedimentary geothe...
Authors
Johnston, H. et al National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitysedimentary basinelko basinrailroad valleysteptoe valleypavant buttedenver basinpiceance basinraton basingulf coast regionnevadautahtexasgbcaasgreat basin carbonate and alluvial aquifer systemcarbonateagsadvanced geothermal systembottom-hole temperaturewell datalcoeeconomicsupperlowercarbonate aquifer unitegsenhanced geothermal systemplay fairway analysiscoloradotemperaturebottom-holemarys river basindrillingpermeabilityreservoirmodelingcarbonate geothermal systemcgstechno-economicanalysisdownselectsubsurfacedata mininggeologygradientheatflowgeophysicsseismicclosed-loophydrogeologycoststructuralbedrockmapaquifersedgeo

Tularosa Basin Play Fairway Analysis: Partial Basin and Range Heat and Zones of Critical Stress Maps

Nov 15, 2015
3.06 MB
Publicly accessible
Interpolated maps of heat flow, temperature gradient, and quartz geothermometers are included as TIF files. Zones of critical stress map is also included as a TIF file. The zones are given a 5km diameter buffer. The study area is only a part of the Basin and Range, but it does inc...
Authors
Brandt, A. University of Utah
geothermalfort blisstularosa basintularosanew mexicocritical stressquartz geothermometerheat flowheatflowtemperature gradientmapsmapbasin and rangegreat basinutahnevadainterpolationextrapolationquartzgeothermometertemperaturegradientzonesfaultpermeabilitypfaplay fairway analysisgeothermometrygeospatial data

CIRES Approach Overview to Using Thermal Infrared Imagery to Find Geothermal Systems in Colorado

Feb 01, 2012
237.36 kB
Publicly accessible
Subsurface geothermal activity has a thermal expression that can be observed at the surface. Such spatial temperature gradients are within the radiometric resolution that is characteristic of a wide range of satellites that carry thermal sensors. For this effort, CIRES (part of ...
Authors
Hussein, K. Flint Geothermal, LLC
geothermalcoloradociresasterlandsatremote sensingthermal infraredtarget areasgeothermal potentialidentifydeep resource wellspotential

Utah FORGE: GIS Well Temperature Data

Feb 28, 2018
15.77 kB
Publicly accessible
This is a GIS point feature shapefile representing wells, and their temperatures, that are located in the general Utah FORGE area near Milford, Utah. There are also fields that represent interpolated temperature values at depths of 200 m, 1000 m, 2000 m, 3000 m, and 4000 m. in deg...
Authors
Gwynn, M. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgeroosevelt hot springsforgewell temperaturesheat flowgeospatial datagis datashapefileutah forge well temperaturesarcgisutahtemperaturewell dataresourcecharacterizationmilfordinterpolatedprocessed dataegs

Utah FORGE: Native State Numerical Model 2025 Update

Jan 30, 2026
456.3 MB
Publicly accessible
This dataset contains a three-dimensional native-state numerical model of the Utah FORGE site, updated in 2025, representing thermal, hydraulic, and stress conditions within the granitic reservoir and overlying sedimentary formations. The model domain extends 6 km by 6 km laterall...
Authors
Vazic, B. et al Idaho National Laboratory
geothermalenergyforgenative state modelutah forgeegsnumerical simulationgeothermal reservoirthermal-hydraulic modelingin-situ stressgranitic reservoirmoosesubsurface temperaturepore pressuremesh

Tularosa Basin Play Fairway Analysis Data and Models

Jul 11, 2017
1.68 MB
Publicly accessible
This submission includes raster datasets for each layer of evidence used for weights of evidence analysis as well as the deterministic play fairway analysis (PFA). Data representative of heat, permeability and groundwater comprises some of the raster datasets. Additionally, the fi...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyplay fairway analysispfatularosanew mexicoheatpermeabilitygroundwaterexplorationresource assessmenttularosa basinmodelarcgisshapefilegisgeospatial datagis layerprobabilityweights of evidenceraster

Archuleta County CO Lineaments

Jan 01, 2012
8.49 kB
Publicly accessible
This layer traces apparent topographic and air-photo lineaments in the area around Pagosa springs in Archuleta County, Colorado. It was made in order to identify possible fault and fracture systems that might be conduits for geothermal fluids. Geothermal fluids commonly utilize fa...
Authors
E., R. Flint Geothermal, LLC
geothermalarchuleta countycoloradolineamentsarcgisshapefileshape filegeospatialgisdatafaultfracturesystemsgeothermal fluidsflow testexplorationgeospatial data

Hawaii Play Fairway: Preliminary Core Box Photos, Lanai Island, Hawaii

Jul 01, 2019
Size unavailable
Publicly accessible
Photos of core samples from Lanai Island. During the third phase of the Hawaii Play Fairway project, further exploration involved drilling a groundwater well in Lanai's Palawai Basin and performing more geophysical surveys. The project deepened an existing water well on Lanai. Dri...
Authors
Lautze, N. et al University of Hawaii
geothermalenergyhawaiilanaipfaplay fairway analysiscore photoscorewell datapalawai basinexplorationcharacterizationhydrothermalkerz

Tularosa Basin Play Fairway Analysis: Weights of Evidence; Mineralogy, and Temperature Anomaly Maps

Nov 15, 2015
915.34 kB
Publicly accessible
This submission has two shapefiles and a tiff image. The weights of evidence analysis was applied to data representing heat of the earth and fracture permeability using training sites around the Southwest; this is shown in the tiff image. A shapefile of surface temperature anomali...
Authors
Brandt, A. University of Utah
geothermaltularosa basinnewmexicotexasoutcrop mineralogyasteregsweights of evidencewofepfatemperatureanomaliythermal infraredsurfaceanomaliestularosabasinnew mexicoplay fairway anlaysisoutcropmineralogygeospatial data

Geothermal Resource at the McGee Mountain Prospect, Humboldt County, Nevada

Jul 01, 2010
2.64 MB
Publicly accessible
This report describes the geothermal resource at McGee Mountain, including: 1. Local geology 2. Thermal features 3. Known boreholes and temperature gradients 4. Geophysical surveys 5. Fluid geochemistry and geothermometry 6. Estimate of the heat-in-place Description of the heat-i...
Authors
Zehner, R. Geothermal Technical Partners, Inc.
geothermalnevadamcgee mountaingeologygeochemistrymonte carloheat in place estimatereportthermal featuresborehole gradienttemperature gradientgeophysicsgeophysical surveyboreholebore holegeothermometryfluidheat-in-place

Techno-Economic Simulation Results Using dGeo for EGS-Based District Heating in the Northeastern United States

Sep 30, 2024
3.1 MB
Publicly accessible
This dataset presents the results of techno-economic simulations performed using the Distributed Geothermal Market Demand Model (dGeo) to evaluate the feasibility of Enhanced Geothermal Systems (EGS)-based district heating in the Northeastern United States. Developed by the Nation...
Authors
Pauling, H. National Renewable Energy Laboratory
geothermalenergyegsdistrict heatingdgeoteatechno-economic analsyisfeasibilityegs feasibilityegs direct usedeep direct usedudducapexopexlcohmodelinggeothermal market demandmodelsimulationthermal demandheating demanddistrict heating networks

A Thermal-Hydrological-Chemical Model for the EGS Demonstration Project at Newberry Volcano, OR

Jan 30, 2012
Size unavailable
Publicly accessible
Newberry Volcano in Central Oregon is the site of a Department of Energy funded Enhanced Geothermal System (EGS) Demonstration Project. Stimulation and production of an EGS is a strong perturbation to the physical and chemical environment, giving rise to coupled Thermal-Hydrologic...
Authors
Sonnenthal, E. et al National Energy Technology Laboratory
geothermalnewberryoregonegsenhanced geothermal systemnewgenthermalhydrologychemicalmodelcross-sectionsstimulationinjectionhydrologicaldemonstrationmechanical

Utah FORGE: Phase 2C Seismic Observation and Ground Water Well Data and Well Locations

Mar 26, 2019
171.52 MB
Publicly accessible
This submission contains the following data associated with Utah FORGE Phase 2C within the Roosevelt Hot Springs geothermal area: An ArcGIS shapefile with well locations for wells 58-32, 78-32, 68-32, OH-3, OH-4, WOW-2, and WOW-3. Well 58-32 is the deep test well, wells 68-32 an...
Authors
Abraham, S. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 78-32utah forgeutah forge phase 2cseismic monitoring wellutahlithologic logsdaily drilling reportsdrilling reportdrilling photosegscuttings logutah geothermalwell 68-32phase 2cthermal gradienttemperature logsutah forge temerature gradientswell oh-3well oh-4well wow-4well locationswells58-3268-32oh-3oh-4wow-2wow-3well wow-3well wow-2borehole logginggeophysicsground watermilforddrillingdatawelllocationforgewell dataresourcecharacterizationroosevelt hot springswell locationlithologycuttingsraw datapost-processedprocessed datatemperatureseismic monitoringseismicgeospatial dataarcgisshapefile

Tularosa Basin Play Fairway Analysis Model

Nov 15, 2015
4.01 MB
Publicly accessible
This submission contains several shapefiles used for a deterministic PFA, as well as a heat composite risk segment with union overlay, and training sites used for weights of evidence. More detailed metadata can be found in the specific file.
Authors
Brandt, A. University of Utah
geothermalplay fairway analysispfacrstularosabasinnew mexicofort blissmcgregor rangeweights of evidenceheat crsuniondissolvecertaintytrainingsitesheatcompositerisksegmentplayfairwayanalysisshapefileshape filegisarcgisgeospatial data

Establishing the Frontier Observatory for Research in Geothermal Energy (FORGE) on the Newberry Volcano, OR

Feb 22, 2016
Size unavailable
Publicly accessible
The proposed Newberry Volcano FORGE site is in central Oregon on the northwest flank of the largest volcano in the Cascades volcanic arc. Beneath Newberry Volcano is one of the largest geothermal heat reservoirs in the western United States, extensively studied for the last 40 yea...
Authors
Bonneville, A. et al Pacific Northwest National Laboratory
geothermalegsenhanced geothermal systemnewgenforgenewberryoregon

Topographic and Air-Photo Lineaments in Various Locations Related to Geothermal Exploration in Colorado

Feb 01, 2012
235.87 kB
Publicly accessible
These line shapefiles trace apparent topographic and air-photo lineaments in various counties in Colorado. It was made in order to identify possible fault and fracture systems that might be conduits for geothermal fluids, as part of a DOE reconnaissance geothermal exploration prog...
Authors
Zehner, R. Flint Geothermal, LLC
geothermalstructurelineamentsair-photoscoloradoalamosa countyarcheluta countychaffee countydelta countydolores countyeagle countygarfield countymineral countypark countyroutt countysan miguel countyshapefileshape fileexplorationgisarcgisgeospatialdatageospatial datageochemistry

New Mexico Geothermal Play Fairway Analysis from LANL

Oct 27, 2015
2.57 GB
Publicly accessible
This submission contains geospatial (GIS) data on water table gradient and depth, subcrop gravity and magnetic, propsectivity, heat flow, physiographic, boron and BHT for the Southwest New Mexico Geothermal Play Fairway Analysis by LANL Earth & Environmental Sciences. GIS data is...
Authors
Kelley, R. Los Alamos National Laboratory
geothermaltemperaturebasementwellbottomlocationboronconcentrationdataavailabilitydensitydischargedischarge zonedemgeomorphologyelevationsgroundwatersubcropgradientheat flowheat generationwellsphysiographygeographyrangesprospectivitygeothermometerstructuregeologybouguer gravitymagneticprecambriancrystallinehydrogeologic windowselevationcontourswater tabledepthnew mexicosouthwestlanlpfaplayfairwayanalysiswell locations30ctopographylithiumwatersilicamagnetics contoursgisgeospatial dataarcgismap packagempk

Appalachian Basin Temperature-Depth Maps and Structured Data in support of Feasibility Study of Direct District Heating for the Cornell Campus Utilizing Deep Geothermal Energy

Oct 29, 2019
229.82 MB
Publicly accessible
This dataset contains shapefiles and rasters that summarize the results of a stochastic analysis of temperatures at depth in the Appalachian Basin states of New York, Pennsylvania, and West Virginia. This analysis provides an update to the temperature-at-depth maps provided in the...
Authors
Smith, J. Cornell University
geothermalenergycornell universitylow-temperature geothermalreservoir simulationuncertainty analysisthermal datadistrict heatingdirect-use heatingdduappalachian basinnew york statetechno-economic analysislevelized cost of heat lcohexternality valuesenvironmental valuemonte carlo analysismonte carloeconomiceaheat pumpghpshapefilerastercornellgeospatial data

Maps, Models and Data from Southeastern Great Basin PFA

Jun 30, 2017
846.11 kB
Publicly accessible
This submission includes composite risk segment models in raster format for permeability, heat of the earth, and MT, as well as the final PFA model of geothermal exploration risk in Southwestern Utah, USA. Additionally, this submission has data regarding hydrothermally altered are...
Authors
Nash, G. Energy and Geoscience Institute at the University of Utah
geothermalenergyexplorationplay fairway analysisutahheatpermeabilityopalmtmagnetotelluricpfahydrothermal alterationsinterhidden geothermal systemsblind geothermal systemsshapefileshape filearcgisgisgeospatial dataxrdx-ray diffractionmilfordphase 2segbgbgreat basinse great basineasterngeophysicsheat floweastern great basinhydrothermal
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service